close all open/close all

CDS information : Grana_00080


close this sectionLocation

Organism
StrainTü22
Entry nameGranaticin
Contig
Start / Stop / Direction10,515 / 9,367 / - [in whole cluster]
10,515 / 9,367 / - [in contig]
Locationcomplement(9367..10515) [in whole cluster]
complement(9367..10515) [in contig]
TypeCDS
Length1,149 bp (382 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative C-glycosyltransferase
Product (GenBank)putative glycosyl transferase
Gene
Gene (GenBank)gra-orf14
EC number
Keyword
  • D-olivose
Note
Note (GenBank)
Reference
ACC
PmId
[7476861] Identification of Streptomyces violaceoruber Tu22 genes involved in the biosynthesis of granaticin. (Mol Gen Genet. , 1995)
[9831526] The granaticin biosynthetic gene cluster of Streptomyces violaceoruber Tu22: sequence analysis and expression in a heterologous host. (Chem Biol. , 1998)
Related Reference
ACC
Q9ZGC0
NITE
Lando_00200
PmId
[15977274] LanGT2 Catalyzes the First Glycosylation Step during landomycin A biosynthesis. (Chembiochem. , 2005)
[21513888] Rational design of an aryl-C-glycoside catalyst from a natural product O-glycosyltransferase. (Chem Biol. , 2011)
ACC
Q9RPA7
NITE
Urd_00200
PmId
[10658661] Two new tailoring enzymes, a glycosyltransferase and an oxygenase, involved in biosynthesis of the angucycline antibiotic urdamycin A in Streptomyces fradiae Tu2717. (Microbiology. , 2000)
[17640665] Structure and action of the C-C bond-forming glycosyltransferase UrdGT2 involved in the biosynthesis of the antibiotic urdamycin. (J Mol Biol. , 2007)
[12696864] The C-Glycosyltransferase UrdGT2 is unselective toward d- and l-configured nucleotide-bound rhodinoses. (J Am Chem Soc. , 2003)

close this sectionSequence

selected fasta
>putative C-glycosyltransferase [putative glycosyl transferase]
MRFLFVSGGSAGAVFPITPLALAARNAGHEVIVGATENVMPLVAATGLPGAPITSRTMFD
FMQRDRHGNPLEIPKDPHERNLFNGRGMARLALGSMEGLVPLVERWQPDVLVAGALSYAA
PLVAHRFGLPWVRHALNMGEPSIIDLSAAAELAPELEEMGLSAIPEPDMYVEICPPGARR
PDAGPAQFMRYVPFNTQRALEPWMYAKGDRPRVLVSAGSRVTADYEADALSALVEKVAGL
DVELLIAAPQEIADALGDLPDNVRAGCVPLDVVLRTCDLLVHRAGGNTMLHAIVCGVPQL
VIPAMPKQVGMSARLAEYGAAIMLTAGQDDSPENVAKACRELLEDPAYKARTDELSREIA
GLPAPHDVTVAITEMVRARARG
selected fasta
>putative C-glycosyltransferase [putative glycosyl transferase]
ATGAGATTCCTTTTTGTGTCCGGAGGAAGCGCGGGGGCGGTCTTCCCCATCACCCCGCTG
GCGTTGGCGGCGCGCAACGCCGGCCACGAGGTGATCGTCGGAGCCACGGAGAACGTGATG
CCGCTGGTCGCCGCGACCGGACTGCCCGGCGCCCCGATCACCTCGCGCACCATGTTCGAC
TTCATGCAGCGCGACCGGCACGGCAATCCGCTGGAGATCCCCAAGGACCCTCACGAGCGG
AACCTGTTCAACGGCCGCGGCATGGCCCGCCTCGCCCTCGGCAGCATGGAGGGACTCGTT
CCGCTGGTCGAGCGCTGGCAGCCGGACGTCCTGGTCGCCGGAGCGCTCTCGTACGCCGCG
CCCCTGGTGGCCCACCGCTTCGGCCTGCCCTGGGTGCGCCACGCGCTCAACATGGGCGAG
CCGTCCATCATCGATCTCTCCGCCGCCGCCGAACTGGCGCCGGAGCTCGAGGAGATGGGC
CTGTCCGCGATACCCGAACCGGACATGTACGTGGAGATCTGCCCGCCCGGCGCCCGCCGC
CCGGACGCGGGGCCCGCACAGTTCATGCGATACGTCCCCTTCAACACGCAGCGGGCCCTG
GAGCCCTGGATGTACGCCAAGGGCGACCGGCCGCGCGTGCTGGTCTCGGCGGGCAGCCGG
GTCACCGCCGACTATGAGGCCGACGCCCTGTCCGCCCTGGTGGAGAAGGTCGCCGGACTC
GACGTGGAACTCCTCATCGCGGCACCGCAGGAGATCGCCGACGCCCTCGGCGATCTGCCG
GACAACGTGCGCGCCGGCTGCGTGCCGCTCGACGTCGTCCTGCGCACCTGTGACCTGCTG
GTGCACCGGGCCGGCGGCAACACGATGCTGCACGCGATCGTGTGCGGCGTCCCGCAGCTG
GTGATCCCCGCCATGCCGAAGCAGGTGGGGATGTCCGCCCGGCTCGCGGAGTACGGCGCC
GCCATCATGCTGACCGCCGGGCAGGACGACTCTCCCGAGAACGTGGCCAAGGCCTGCCGG
GAGTTGCTGGAGGACCCGGCGTACAAGGCCAGGACCGACGAGTTGAGCCGGGAGATCGCG
GGTCTGCCCGCGCCCCACGACGTGACGGTGGCGATCACCGAAATGGTGCGCGCCCGGGCC
CGGGGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002213 UDP-glucuronosyl/UDP-glucosyltransferase (Family)
 [281-357]  1.2e-05 PF00201
PF00201   UDPGT
IPR004276 Glycosyl transferase, family 28 (Domain)
 [3-141]  2.7e-22 PF03033
PF03033   Glyco_transf_28
IPR010610 Domain of unknown function DUF1205 (Domain)
 [171-264]  3.3e-26 PF06722
PF06722   DUF1205
SignalP
 [1-23]  0.992 Signal
Bacteria, Gram-negative   
 [1-23]  0.934 Signal
Eukaryota   
 [1-23]  0.968 Signal
Bacteria, Gram-positive   
TMHMM No significant hit