close all open/close all

CDS information : Grana_00090


close this sectionLocation

Organism
StrainTü22
Entry nameGranaticin
Contig
Start / Stop / Direction10,869 / 12,542 / + [in whole cluster]
10,869 / 12,542 / + [in contig]
Location10869..12542 [in whole cluster]
10869..12542 [in contig]
TypeCDS
Length1,674 bp (557 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative drug resistance transporter
Product (GenBank)putative transmembrane protein
Gene
Gene (GenBank)gra-orf15
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[7476861] Identification of Streptomyces violaceoruber Tu22 genes involved in the biosynthesis of granaticin. (Mol Gen Genet. , 1995)
[9831526] The granaticin biosynthetic gene cluster of Streptomyces violaceoruber Tu22: sequence analysis and expression in a heterologous host. (Chem Biol. , 1998)
Related Reference
ACC
Q53769
PmId
[8534971] A self-defense gene homologous to tetracycline effluxing gene essential for antibiotic production in Streptomyces aureofaciens. (Biosci Biotechnol Biochem. , 1995)

close this sectionSequence

selected fasta
>putative drug resistance transporter [putative transmembrane protein]
MTDTANRRSATPDSGADAVDKRRIRLIMTGLLLLGLFMAALDQTIISAALRTIADDLNGL
SEQAWANTSYMITSVIMTALYGKLSDIYGRRPVYCTAVGVFVLGSVLCGLAQSMTTLAVF
RGQGIGAGGLMSLAFAILTDLVPLAERSRYQAWFGAVFGVSAVVGPVAGGFFAGLDSFLG
ASGWRWAFFINVPIGVAGALIIAALVRVQPGRAQHKFDIAGLLALIACLLPLLFAVEQGP
AWGWTDPGTLVLFGLGAVGLVLFSLAQKRAADAALLPTPMFRNPLFSVYNGVNVLVGAAV
FGALSVLPLYLQMVKGLSPTQAGLMMLPQTLGIVVAGRIARPYVTRTGRYKAVLLSGLVL
MVVATFWFGVLTADTSLWQTGVAAGVMGFGIGLCWQVMLIAIQTGVAPQYMGAGMGSFTF
FRQIGGTAGIAVFLSMFFGAVGEKVAAAYRGAASDPAYTAAVNDPAVTGQAANKVLLGPG
RRVGLDNSSFLDHADPRLAKPFLEGLAEAMQTVFVVSGVMLLIALVLAAVPKEKPPRAGR
RFAGRRKETGKQPAAKK
selected fasta
>putative drug resistance transporter [putative transmembrane protein]
ATGACAGACACAGCGAACCGCCGGTCCGCCACGCCCGATTCCGGTGCCGACGCGGTGGAC
AAGCGCAGAATCCGGCTGATCATGACGGGGCTGCTGCTGCTCGGCCTGTTCATGGCCGCC
CTCGACCAGACGATCATCTCGGCGGCGCTGCGTACCATCGCCGACGACCTCAACGGCCTC
TCCGAGCAGGCCTGGGCGAACACCTCGTACATGATCACCTCGGTGATCATGACGGCGCTG
TACGGAAAGCTCTCCGACATCTACGGACGCCGCCCGGTCTACTGCACGGCCGTCGGCGTC
TTCGTCCTCGGCTCCGTACTGTGCGGCCTCGCCCAGTCCATGACCACGCTCGCGGTCTTC
CGCGGCCAGGGCATCGGCGCGGGCGGCCTGATGAGCCTGGCCTTCGCGATCCTCACCGAC
CTGGTGCCGCTCGCCGAACGCAGCCGCTACCAGGCATGGTTCGGCGCGGTCTTCGGTGTC
TCGGCGGTCGTCGGCCCCGTCGCGGGCGGCTTCTTCGCCGGACTCGACAGCTTCCTCGGC
GCGTCCGGCTGGCGCTGGGCCTTCTTCATCAACGTGCCGATCGGTGTGGCGGGCGCGCTG
ATCATCGCCGCGCTGGTCCGCGTCCAGCCGGGACGCGCACAGCACAAGTTCGACATCGCG
GGGCTGCTCGCCCTGATCGCCTGCCTGCTGCCGCTGCTCTTCGCGGTCGAGCAGGGCCCC
GCGTGGGGCTGGACGGACCCCGGGACGCTCGTCCTGTTCGGCCTCGGAGCGGTCGGTCTG
GTGCTCTTCTCGCTGGCGCAGAAGCGGGCCGCCGACGCCGCGCTGCTGCCGACCCCGATG
TTCCGCAACCCGCTCTTCTCCGTCTACAACGGCGTGAACGTCCTGGTCGGAGCGGCGGTC
TTCGGCGCCCTGTCCGTCCTGCCGCTCTACCTCCAGATGGTCAAGGGCCTCTCGCCCACC
CAGGCGGGGCTGATGATGCTGCCGCAGACGCTGGGCATCGTCGTCGCCGGCCGGATCGCC
CGTCCGTACGTCACCAGGACGGGCCGCTACAAGGCGGTGCTGCTCAGCGGCCTGGTGCTG
ATGGTCGTCGCGACCTTCTGGTTCGGCGTGCTCACCGCGGACACCTCGCTGTGGCAGACC
GGTGTCGCCGCCGGGGTGATGGGCTTCGGCATCGGCCTGTGCTGGCAGGTCATGCTGATC
GCGATCCAGACGGGTGTCGCGCCGCAGTACATGGGGGCGGGCATGGGTTCGTTCACCTTC
TTCCGTCAGATCGGCGGTACGGCCGGCATCGCCGTCTTCCTGTCGATGTTCTTCGGCGCG
GTCGGCGAGAAGGTGGCCGCCGCCTACCGGGGCGCGGCCTCCGACCCGGCGTACACGGCG
GCCGTCAACGACCCGGCCGTGACCGGACAGGCCGCGAACAAGGTGCTGCTGGGCCCGGGA
CGGCGGGTGGGGCTGGACAACAGCTCCTTCCTCGATCACGCCGACCCGCGGCTGGCGAAG
CCCTTCCTGGAGGGCCTGGCCGAGGCGATGCAGACGGTCTTCGTGGTCAGCGGGGTCATG
CTGCTGATCGCCCTGGTGCTGGCGGCCGTGCCGAAGGAGAAGCCGCCGCGAGCCGGCCGC
CGGTTCGCCGGGCGCCGCAAGGAGACGGGGAAGCAGCCCGCGGCCAAGAAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR011701 Major facilitator superfamily (Family)
 [32-429]  2.19999999999997e-44 PF07690
PF07690   MFS_1
IPR016196 Major facilitator superfamily domain, general substrate transporter (Domain)
 [1-552]  3.49999466863949e-71 SSF103473
SSF103473   MFS_gen_substrate_transporter
IPR020846 Major facilitator superfamily domain (Domain)
 [28-536]  PS50850
PS50850   MFS
SignalP
 [1-1]  Signal-anchor
Eukaryota   
TMHMM
 [31-53]  Transmembrane (i-o) [63-85]  Transmembrane (o-i) [97-119]  Transmembrane (i-o) [123-145]  Transmembrane (o-i) [152-174]  Transmembrane (i-o) [184-206]  Transmembrane (o-i) [219-238]  Transmembrane (i-o) [248-265]  Transmembrane (o-i) [285-307]  Transmembrane (i-o) [317-339]  Transmembrane (o-i) [352-371]  Transmembrane (i-o) [386-408]  Transmembrane (o-i) [420-442]  Transmembrane (i-o) [509-531]  Transmembrane (o-i)
Transmembrane 14