close all open/close all

CDS information : Grana_00100


close this sectionLocation

Organism
StrainTü22
Entry nameGranaticin
Contig
Start / Stop / Direction12,912 / 13,973 / + [in whole cluster]
12,912 / 13,973 / + [in contig]
Location12912..13973 [in whole cluster]
12912..13973 [in contig]
TypeCDS
Length1,062 bp (353 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative glucose-1-phosphate thymidylyltransferase
putative dTDP-glucose synthase
Product (GenBank)putative dTDP-1-glucose synthase
Genegra-orf16
graD
Gene (GenBank)gra-orf16
EC number2.7.7.24
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[7476861] Identification of Streptomyces violaceoruber Tu22 genes involved in the biosynthesis of granaticin. (Mol Gen Genet. , 1995)
[9831526] The granaticin biosynthetic gene cluster of Streptomyces violaceoruber Tu22: sequence analysis and expression in a heterologous host. (Chem Biol. , 1998)
Related Reference
ACC
Q2HR55
NITE
Sch475_00270
PmId
[18051285] Cloning and expression of glucose-1-phosphate thymidylyltransferase gene (schS6) from Streptomyces sp. SCC-2136. (J Microbiol Biotechnol. , 2007)
ACC
Q194R4
NITE
Mith_00060
PmId
[9150235] Cloning and insertional inactivation of Streptomyces argillaceus genes involved in the earliest steps of biosynthesis of the sugar moieties of the antitumor polyketide mithramycin. (J Bacteriol. , 1997)

close this sectionSequence

selected fasta
>putative glucose-1-phosphate thymidylyltransferase [putative dTDP-1-glucose synthase]
MKALILSGGMGTRLRPFTYSMPKQLVPVANKPILVHCLENVRAIGVEEVAVVVGDRADEV
RAVVGDGSAFGLDVTYLQQEAPLGLAHCVSIAEEFLGDEDFVMYLGDNILAEGIAESARA
FRDERSAARLLLTKVADPRAYGVAETDATGRVHALVEKPERPRSDLAVIGVYFFTAAVHD
AVRAIEPSARGELEITDAIQYLVERGDRVVADEYTGYWKDTGSPDDLLDCNRVLLGRLRP
GVHGEVDAASTVEGTVVVEAGRSWSDSRLVGPLVVGAGSVVRGSELGPYTALGRDCVLED
AGIRDSIVLDGVSIQGVRGLSGSLIGRSAAVRTGEAAGRRLIIGDHTQAEVAA
selected fasta
>putative glucose-1-phosphate thymidylyltransferase [putative dTDP-1-glucose synthase]
ATGAAGGCGCTGATTCTGTCCGGAGGGATGGGGACCAGGTTGCGTCCCTTCACCTATTCC
ATGCCCAAACAACTGGTGCCCGTCGCCAACAAGCCGATCCTCGTGCACTGCCTGGAGAAC
GTCCGTGCCATCGGTGTCGAGGAGGTCGCCGTCGTCGTCGGCGACCGCGCCGACGAGGTC
CGGGCGGTGGTCGGTGACGGCTCCGCGTTCGGCCTCGACGTCACCTACCTCCAGCAGGAG
GCGCCGCTCGGCCTCGCTCACTGCGTCTCCATCGCCGAGGAGTTCCTCGGTGACGAGGAC
TTCGTGATGTACCTGGGCGACAACATCCTCGCTGAGGGCATCGCCGAGTCCGCCCGCGCG
TTCCGCGACGAACGTTCCGCCGCCCGGCTGCTGCTCACCAAGGTGGCCGACCCGCGTGCC
TACGGCGTCGCCGAGACGGATGCCACCGGCAGGGTCCACGCGCTGGTCGAGAAGCCCGAG
CGGCCGCGCAGCGACCTCGCCGTGATCGGCGTGTACTTCTTCACCGCCGCCGTCCACGAC
GCCGTCCGGGCGATCGAGCCGAGCGCCCGCGGCGAACTGGAGATCACCGACGCGATCCAG
TACCTCGTGGAGCGCGGCGACCGGGTCGTCGCCGACGAGTACACCGGCTACTGGAAGGAC
ACCGGCAGCCCCGACGACCTGCTGGACTGCAATCGGGTACTCCTCGGCCGGCTCCGCCCC
GGCGTACACGGCGAGGTCGACGCGGCCAGTACCGTCGAGGGGACCGTGGTCGTCGAGGCG
GGACGGTCGTGGAGCGACTCGCGCCTGGTCGGACCGCTCGTCGTCGGCGCCGGCAGCGTC
GTGCGCGGCAGCGAGCTCGGCCCGTACACCGCTCTCGGCCGCGACTGCGTGCTGGAGGAC
GCGGGGATCCGCGACTCCATCGTGCTCGACGGGGTGTCGATCCAGGGCGTGCGCGGGCTC
TCCGGCTCGCTCATCGGCCGCTCGGCCGCCGTGCGCACCGGCGAGGCGGCCGGACGGCGG
CTCATCATCGGGGACCATACGCAGGCGGAGGTGGCGGCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005835 Nucleotidyl transferase (Domain)
 [2-234]  3.2e-60 PF00483
PF00483   NTP_transferase
IPR005908 Glucose-1-phosphate thymidylyltransferase, long form (Family)
 [2-349]  4.09999999999995e-122 TIGR01208
TIGR01208   RmlA_long
SignalP
 [1-20]  0.269 Signal
Eukaryota   
TMHMM No significant hit