close all open/close all

CDS information : Grana_00110


close this sectionLocation

Organism
StrainTü22
Entry nameGranaticin
Contig
Start / Stop / Direction13,970 / 14,935 / + [in whole cluster]
13,970 / 14,935 / + [in contig]
Location13970..14935 [in whole cluster]
13970..14935 [in contig]
TypeCDS
Length966 bp (321 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
ProductdTDP-glucose 4,6-dehydratase
Product (GenBank)putative dTDP-glucose-4,6-dehydratase
Genegra-orf17
graE
Gene (GenBank)gra-orf17
EC number4.2.1.46
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[7476861] Identification of Streptomyces violaceoruber Tu22 genes involved in the biosynthesis of granaticin. (Mol Gen Genet. , 1995)
[9831526] The granaticin biosynthetic gene cluster of Streptomyces violaceoruber Tu22: sequence analysis and expression in a heterologous host. (Chem Biol. , 1998)

close this sectionSequence

selected fasta
>dTDP-glucose 4,6-dehydratase [putative dTDP-glucose-4,6-dehydratase]
MRLLVTGAAGFIGSHYVREILAGSYPESDDVHVTVVDRLTYAGRRDNLPEHHERLDFVHG
DICDRDLLDRVLPGHDAVVHFAAESHVDRSLTGPGEFVRTNVMGTQQLLDAALHAGVDRV
LHVSTDEVYGSLDSGTWTEDSPLLPNSPYAASKASTTWSAAPTTVRHGLDVRITRCSNNY
GPRQHPEKLIPNFVTRLLTGRQVPLYGDGRNVREWLHVDDHCRALQLVLTKGRAGEIYNI
GGGSGMSNREMTARLLDLLGADWDMVRHVEDRLGHDFRYAIDDSKIREELGYAPRWSIES
GLGAVVDWYRDHPDFWRAPAS
selected fasta
>dTDP-glucose 4,6-dehydratase [putative dTDP-glucose-4,6-dehydratase]
ATGAGGCTCCTGGTCACCGGCGCGGCCGGGTTCATCGGCTCGCACTACGTGCGCGAGATA
CTGGCGGGGAGCTACCCGGAGTCCGACGACGTCCACGTCACGGTCGTCGACCGGCTCACC
TACGCGGGGCGCCGCGACAACCTGCCCGAGCACCACGAACGGCTCGACTTCGTCCACGGC
GACATCTGCGACCGCGACCTCCTGGACCGGGTCCTCCCCGGCCACGACGCGGTCGTGCAC
TTCGCCGCCGAGTCCCACGTGGACCGCTCCCTCACCGGCCCCGGCGAGTTCGTCCGTACG
AACGTCATGGGCACCCAGCAGCTGCTCGACGCCGCACTCCACGCCGGTGTGGACCGAGTC
CTGCACGTCTCCACGGACGAGGTGTACGGCTCGTTGGACAGCGGCACCTGGACCGAGGAC
AGCCCCCTGCTGCCCAACTCCCCCTACGCGGCGTCCAAGGCCTCCACGACCTGGTCCGCC
GCGCCTACCACCGTACGCCACGGACTCGACGTCCGCATCACCCGCTGCTCCAACAACTAC
GGCCCGCGCCAGCACCCCGAGAAGCTCATCCCGAACTTCGTCACCCGGCTGCTGACCGGT
CGGCAGGTTCCGCTGTACGGCGACGGACGCAACGTGCGCGAGTGGCTGCACGTGGACGAC
CACTGCCGGGCGCTGCAACTGGTGCTCACCAAGGGCCGCGCGGGCGAGATCTACAACATC
GGCGGTGGCAGCGGTATGAGCAACCGCGAGATGACCGCCCGCCTGCTGGACCTCCTGGGG
GCGGACTGGGACATGGTGCGCCATGTCGAGGACCGCCTCGGGCACGACTTCCGCTATGCG
ATCGACGACTCCAAGATCCGCGAGGAGCTGGGCTACGCGCCCCGCTGGTCGATCGAGAGC
GGGCTGGGGGCGGTCGTGGACTGGTACCGCGACCACCCCGACTTCTGGCGCGCCCCGGCC
TCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001509 NAD-dependent epimerase/dehydratase (Domain)
 [4-241]  8.70000000000003e-69 PF01370
PF01370   Epimerase
IPR005888 dTDP-glucose 4,6-dehydratase (Family)
 [2-317]  6.60000000000002e-118 TIGR01181
TIGR01181   DTDP_gluc_dehyt
IPR016040 NAD(P)-binding domain (Domain)
 [1-178]  2.59999999999998e-62 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP
 [1-22]  0.714 Signal
Eukaryota   
TMHMM No significant hit