close all open/close all

CDS information : Grana_00120


close this sectionLocation

Organism
StrainTü22
Entry nameGranaticin
Contig
Start / Stop / Direction15,086 / 15,694 / + [in whole cluster]
15,086 / 15,694 / + [in contig]
Location15086..15694 [in whole cluster]
15086..15694 [in contig]
TypeCDS
Length609 bp (202 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)putative cyclase-dehydratase
Genegra-orf18
Gene (GenBank)gra-0rf-18
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[9831526] The granaticin biosynthetic gene cluster of Streptomyces violaceoruber Tu22: sequence analysis and expression in a heterologous host. (Chem Biol. , 1998)
Related Reference
ACC
Q9ADD7
NITE
Actino_00050
PmId
[10805574] Chemical characterisation of disruptants of the Streptomyces coelicolor A3(2) actVI genes involved in actinorhodin biosynthesis. (J Antibiot (Tokyo). , 2000)
[12421300] Primary and secondary metabolism, and post-translational protein modifications, as portrayed by proteomic analysis of Streptomyces coelicolor. (Mol Microbiol. , 2002)

close this sectionSequence

selected fasta
>hypothetical protein [putative cyclase-dehydratase]
MPALRSRTRTAAIAVPLALAGLMATTSGAQAAPVKTYFDCRVGTVTGLAYSTYVDGVAPA
HVRPGATFDVTLDPAPITPNPAYNKEVKNVALQFKLPAGAKVLSYEVADRLAAGTPELQI
DGTKAVLRAAGPYVANAPFDLPKITIKLKAPTTRGTLETPFGGTSHDDPGFTWTFISPNW
TGEAQLACWPDQPIALTKTLVK
selected fasta
>hypothetical protein [putative cyclase-dehydratase]
ATGCCCGCACTGCGCAGCCGTACCCGTACCGCCGCCATAGCCGTCCCGCTGGCCCTGGCC
GGTCTGATGGCCACCACCTCGGGAGCCCAGGCCGCCCCCGTGAAGACCTACTTCGACTGC
CGCGTCGGCACCGTCACCGGTCTCGCGTACAGCACGTACGTCGACGGCGTGGCCCCGGCC
CACGTCCGGCCCGGAGCGACCTTCGACGTCACGCTCGACCCGGCCCCGATCACCCCGAAC
CCCGCCTACAACAAGGAGGTCAAGAACGTCGCGCTGCAGTTCAAGCTGCCCGCCGGCGCC
AAGGTCCTCTCCTACGAGGTCGCCGACCGGCTGGCCGCCGGCACCCCCGAGCTGCAGATC
GACGGCACCAAGGCCGTGCTGCGCGCCGCCGGGCCGTACGTCGCCAACGCCCCCTTCGAC
CTGCCGAAGATCACCATCAAGCTGAAGGCCCCCACCACCCGGGGCACCCTGGAGACGCCC
TTCGGCGGCACGTCGCACGACGACCCGGGCTTCACCTGGACCTTCATCTCCCCGAACTGG
ACCGGCGAGGCCCAGCTCGCCTGCTGGCCCGACCAGCCGATCGCGCTGACCAAGACGCTG
GTCAAGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP
 [1-31]  1 Signal
Bacteria, Gram-positive   
 [1-31]  1 Signal
Bacteria, Gram-negative   
 [1-31]  1 Signal
Eukaryota   
TMHMM
 [12-34]  Transmembrane (i-o)
Transmembrane 1