close all open/close all

CDS information : Grana_00130


close this sectionLocation

Organism
StrainTü22
Entry nameGranaticin
Contig
Start / Stop / Direction15,846 / 16,508 / + [in whole cluster]
15,846 / 16,508 / + [in contig]
Location15846..16508 [in whole cluster]
15846..16508 [in contig]
TypeCDS
Length663 bp (220 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)putative disulphide bond-forming protein
Gene
Gene (GenBank)gra-orf19
EC number
Keyword
Note
Note (GenBank)
  • contains possible CXXC motif (glutaredoxin/thioredoxin superfamily)
Reference
ACC
PmId
[9831526] The granaticin biosynthetic gene cluster of Streptomyces violaceoruber Tu22: sequence analysis and expression in a heterologous host. (Chem Biol. , 1998)

close this sectionSequence

selected fasta
>hypothetical protein [putative disulphide bond-forming protein]
MKIEIWSDIMCPWCYIGKARLDRAIERLGGGGHDAGGRGAGGRDDIEVVWRSFELRPDQP
RTPGATLGEMMREKLGLQPGETVELFEKIRVLGEAEGLDIRLTGVRPVNSFDAQRLVHLA
AESGLAHRMKSELFRAYLTDQQNVRTHEVLLRTATRAGLDADAAGAVLAGDAYGEDVRED
ERSAAHRGVTGVPTVFVDGVRVATGVPSVDQFHRALVEAG
selected fasta
>hypothetical protein [putative disulphide bond-forming protein]
GTGAAGATCGAGATCTGGTCCGACATCATGTGCCCGTGGTGCTACATCGGCAAGGCGCGG
CTCGACCGGGCGATCGAGCGTCTCGGCGGGGGCGGCCATGACGCCGGTGGGCGTGGTGCC
GGTGGGCGTGACGACATCGAGGTCGTGTGGCGCAGCTTCGAACTCCGTCCCGATCAGCCC
CGCACGCCCGGTGCTACGCTCGGCGAGATGATGCGGGAGAAGCTCGGACTCCAACCCGGC
GAGACGGTCGAGCTGTTCGAGAAGATCCGCGTCCTGGGTGAGGCCGAGGGCCTGGACATC
CGGCTCACCGGCGTACGCCCCGTCAACTCCTTCGACGCGCAGCGCCTGGTGCATCTCGCC
GCCGAGAGCGGCCTCGCGCACCGGATGAAGAGCGAACTTTTCCGTGCATATCTGACGGAC
CAGCAGAACGTGCGGACCCACGAGGTCCTGCTGCGCACCGCGACCCGCGCGGGCCTGGAC
GCCGACGCGGCCGGTGCGGTGCTCGCGGGCGACGCCTACGGCGAGGATGTCCGCGAGGAC
GAGCGGTCCGCAGCCCACCGGGGGGTCACCGGCGTGCCGACGGTCTTCGTCGACGGCGTA
CGGGTCGCCACCGGAGTGCCGTCGGTCGACCAGTTCCACCGGGCGCTGGTGGAGGCCGGC
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001853 DSBA-like thioredoxin domain (Domain)
 [2-216]  1e-64 PF01323
PF01323   DSBA
IPR012336 Thioredoxin-like fold (Domain)
 [1-219]  2.69998997787809e-42 SSF52833
SSF52833   Thiordxn-like_fd
 [2-58]  1.2e-20 G3DSA:3.40.30.10 [108-214]  1.2e-20 G3DSA:3.40.30.10
G3DSA:3.40.30.10   Thioredoxin_fold
SignalP
 [1-24]  0.11 Signal
Bacteria, Gram-negative   
TMHMM No significant hit