close all open/close all

CDS information : Grana_00140


close this sectionLocation

Organism
StrainTü22
Entry nameGranaticin
Contig
Start / Stop / Direction16,510 / 17,100 / + [in whole cluster]
16,510 / 17,100 / + [in contig]
Location16510..17100 [in whole cluster]
16510..17100 [in contig]
TypeCDS
Length591 bp (196 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative transcriptional regulator
Product (GenBank)putative transcriptional activator
Gene
Gene (GenBank)gra-orf20
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[9831526] The granaticin biosynthetic gene cluster of Streptomyces violaceoruber Tu22: sequence analysis and expression in a heterologous host. (Chem Biol. , 1998)
Related Reference
ACC
E3T498
PmId
[21604555] [Function of the granaticin biosynthetic gene orf20 from Streptomyces vietnamensis]. (Wei Sheng Wu Xue Bao. , 2011)

close this sectionSequence

selected fasta
>putative transcriptional regulator [putative transcriptional activator]
MTVARPAHHVTELTVGQLSARSGVAVTALHFYESKGLIKSRRTPGNQRRYTRDTLRRISV
IRVAQRMGIPLSTVAEALAELPEERTPTREDWARLSRRWRADLNERIEQLLALRDGLEDC
IGCGCLSVRDCPLTNPYDELGEEGPGPRRLLREPTGAAARGGARGRARTARTAERTAPVA
DPCGGVSPSCQGGATD
selected fasta
>putative transcriptional regulator [putative transcriptional activator]
ATGACCGTCGCCCGGCCCGCGCACCACGTCACCGAACTCACCGTCGGACAGCTGTCGGCG
CGCAGCGGCGTCGCGGTCACGGCCCTGCACTTCTACGAGTCCAAGGGGCTCATCAAGAGC
CGCCGGACGCCCGGAAACCAGCGCCGCTACACACGGGACACGCTGCGCCGCATCTCCGTC
ATCCGGGTGGCGCAGCGCATGGGCATCCCGCTGAGCACGGTCGCCGAGGCGCTGGCCGAG
CTGCCCGAGGAGCGCACGCCCACCCGGGAGGACTGGGCCCGGCTCTCGCGGCGCTGGCGC
GCGGACCTCAACGAGCGGATCGAGCAGCTGCTCGCGCTCCGCGACGGCCTGGAGGACTGC
ATCGGCTGTGGCTGTCTGTCGGTACGGGACTGCCCGCTGACCAATCCGTACGACGAGCTC
GGCGAGGAGGGTCCGGGGCCGCGCCGCCTGCTGCGCGAACCGACGGGCGCGGCGGCCCGC
GGCGGTGCCCGCGGCCGGGCGCGCACGGCCCGTACGGCGGAAAGGACCGCCCCCGTGGCC
GATCCGTGCGGGGGCGTGAGCCCGTCCTGCCAGGGCGGCGCGACCGACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000551 Transcription regulator HTH, MerR (Domain)
 [14-50]  4.3e-12 PF00376
PF00376   MerR
 [14-25]  8.90000829418053e-12 PR00040 [25-38]  8.90000829418053e-12 PR00040 [48-68]  8.90000829418053e-12 PR00040
PR00040   HTHMERR
 [16-38]  PS00552
PS00552   HTH_MERR_1
 [12-80]  PS50937
PS50937   HTH_MERR_2
 [13-81]  2.70000183580794e-29 SM00422
SM00422   HTH_MERR
IPR009061 DNA binding domain, putative (Domain)
 [13-137]  2.19999900980708e-28 SSF46955
SSF46955   Putativ_DNA_bind
IPR010211 Redox-sensitive transcriptional activator SoxR (Family)
 [12-151]  2.59999999999995e-68 TIGR01950
TIGR01950   SoxR
IPR015358 Transcription regulator MerR, DNA binding (Domain)
 [55-120]  4.6e-16 PF09278
PF09278   MerR-DNA-bind
SignalP No significant hit
TMHMM No significant hit