close all open/close all

CDS information : Grana_00150


close this sectionLocation

Organism
StrainTü22
Entry nameGranaticin
Contig
Start / Stop / Direction18,408 / 17,206 / - [in whole cluster]
18,408 / 17,206 / - [in contig]
Locationcomplement(17206..18408) [in whole cluster]
complement(17206..18408) [in contig]
TypeCDS
Length1,203 bp (400 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative FMNH2-dependent monooxygenase
Product (GenBank)putative hydroxylase
Gene
Gene (GenBank)gra-orf21
EC number
Keyword
  • two-component system
  • C-6 quinone formation
  • C-8 hydroxylate
Note
Note (GenBank)
Reference
ACC
PmId
[9831526] The granaticin biosynthetic gene cluster of Streptomyces violaceoruber Tu22: sequence analysis and expression in a heterologous host. (Chem Biol. , 1998)
[23601640] Biosynthetic conclusions from the functional dissection of oxygenases for biosynthesis of actinorhodin and related streptomyces antibiotics. (Chem Biol. , 2013)
Related Reference
ACC
Q53907
NITE
Actino_00110
PmId
[18245777] Mechanism and regulation of the Two-component FMN-dependent monooxygenase ActVA-ActVB from Streptomyces coelicolor. (J Biol Chem. , 2008)
[19246012] Biosynthesis of actinorhodin and related antibiotics: discovery of alternative routes for quinone formation encoded in the act gene cluster. (Chem Biol. , 2009)
[22086671] Epoxyquinone formation catalyzed by a two-component flavin-dependent monooxygenase involved in biosynthesis of the antibiotic actinorhodin. (Chembiochem. , 2011)
[23601640] Biosynthetic conclusions from the functional dissection of oxygenases for biosynthesis of actinorhodin and related streptomyces antibiotics. (Chem Biol. , 2013)

close this sectionSequence

selected fasta
>putative FMNH2-dependent monooxygenase [putative hydroxylase]
MPTQQTSRQISDPQISAPQISAPPAAVDPASGIDSAAVVVAAVDVAKIAAEHARAAERDR
RLSPEVVRSMLDAGFARHFVPRRHGGDAGTFEEIVRAVAVVGEGCTSAAWAASLTASLGR
MAAYLPEAGRRRIWAGGPDTLIVGALMPFGRARREEGGWRIGGTWPYVSVVDHADWALVC
AMTTEERPVVRFFAVPRGSWRSEDTWSSVGMRGTGSNTLHVEDVFVSDELTFTRDAVATG
VAEDAEAPCHRVPLKAVNGLCFAAPVLGAARAALTAWREGTAPRHTSASGGLESAAAVVL
GRAAGEVDTAALLLESAVRRADSGRVTDLEVARNSRDCALAAELATAVVDRLFTSVGTRA
HQESVPLQCHWWHAHSVAGHVVLGFPAAAETYARELQREK
selected fasta
>putative FMNH2-dependent monooxygenase [putative hydroxylase]
ATGCCGACACAGCAGACGTCACGGCAGATCTCCGACCCCCAGATCTCCGCTCCGCAGATC
TCCGCACCGCCGGCAGCCGTGGATCCGGCGTCCGGTATCGATTCCGCCGCCGTCGTCGTC
GCGGCGGTCGATGTCGCCAAGATCGCCGCGGAACACGCACGGGCCGCCGAGCGCGACCGC
AGGCTCTCCCCGGAGGTCGTACGGTCCATGCTGGACGCCGGCTTCGCCCGCCACTTCGTG
CCCCGTCGGCACGGCGGCGACGCCGGAACGTTCGAGGAGATCGTCCGGGCCGTGGCCGTC
GTCGGCGAAGGCTGCACGTCGGCCGCCTGGGCCGCCTCGCTGACCGCCTCCCTCGGCAGG
ATGGCGGCCTACCTCCCCGAAGCCGGCCGGCGGCGGATCTGGGCGGGCGGTCCTGACACC
CTGATCGTCGGCGCTCTGATGCCCTTCGGCCGGGCCCGGCGGGAGGAGGGCGGCTGGCGC
ATCGGCGGCACCTGGCCCTACGTCAGCGTCGTCGACCACGCCGACTGGGCGCTGGTGTGC
GCGATGACGACGGAGGAACGGCCGGTGGTCCGTTTCTTCGCCGTGCCCCGTGGTAGCTGG
CGCAGCGAGGACACCTGGTCGTCGGTCGGCATGCGCGGCACCGGCAGCAACACGCTCCAC
GTCGAGGACGTCTTCGTGTCCGACGAGCTGACCTTCACCCGGGACGCCGTCGCCACGGGC
GTCGCCGAGGACGCCGAGGCGCCCTGCCACCGTGTGCCGCTCAAGGCCGTCAACGGTCTG
TGTTTCGCCGCCCCCGTGCTGGGCGCCGCGCGCGCCGCCCTGACCGCCTGGCGTGAGGGC
ACCGCGCCCCGCCACACGTCGGCCTCGGGCGGTCTGGAGAGTGCGGCGGCCGTGGTCCTC
GGCCGGGCCGCGGGCGAGGTGGACACGGCGGCGCTCCTGCTGGAGTCGGCGGTCCGCAGG
GCGGACAGCGGCCGGGTGACCGATCTCGAGGTGGCCCGCAACAGTCGGGACTGTGCCCTC
GCCGCCGAGCTGGCCACGGCCGTCGTCGACCGGCTCTTCACCTCCGTGGGCACCCGCGCC
CACCAGGAGTCGGTGCCGCTCCAGTGTCACTGGTGGCACGCCCACTCGGTGGCCGGCCAC
GTCGTGCTCGGCTTCCCGGCCGCGGCCGAGACGTACGCCCGCGAGCTGCAGCGCGAGAAG
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006091 Acyl-CoA oxidase/dehydrogenase, central domain (Domain)
 [145-217]  5.69999999999998e-26 G3DSA:2.40.110.10
G3DSA:2.40.110.10   Acyl_CoA_DH/ox_M
IPR009075 Acyl-CoA dehydrogenase/oxidase C-terminal (Domain)
 [218-396]  3.7e-29 G3DSA:1.20.140.10
G3DSA:1.20.140.10   AcylCoA_DH_1/2_C
IPR009100 Acyl-CoA dehydrogenase/oxidase (Domain)
 [27-234]  5.59999989417023e-30 SSF56645
SSF56645   AcylCoA_dehyd_NM
IPR013107 Acyl-CoA dehydrogenase, type 2, C-terminal (Domain)
 [260-383]  3.5e-32 PF08028
PF08028   Acyl-CoA_dh_2
IPR013786 Acyl-CoA dehydrogenase/oxidase, N-terminal (Domain)
 [34-140]  2.90000000000001e-28 G3DSA:1.10.540.10
G3DSA:1.10.540.10   AcylCoA_DH/ox_N
SignalP
 [1-25]  0.186 Signal
Bacteria, Gram-positive   
TMHMM No significant hit