close all open/close all

CDS information : Grana_00160


close this sectionLocation

Organism
StrainTü22
Entry nameGranaticin
Contig
Start / Stop / Direction18,558 / 19,472 / + [in whole cluster]
18,558 / 19,472 / + [in contig]
Location18558..19472 [in whole cluster]
18558..19472 [in contig]
TypeCDS
Length915 bp (304 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose C-4 ketoreductase
Product (GenBank)putative dTDP4-keto-6-deoxyhexose reductase
Gene
Gene (GenBank)gra-orf22
EC number
Keyword
  • L-rhodinose
Note
Note (GenBank)
Reference
ACC
PmId
[9831526] The granaticin biosynthetic gene cluster of Streptomyces violaceoruber Tu22: sequence analysis and expression in a heterologous host. (Chem Biol. , 1998)
[11269719] Identification of four genes from the granaticin biosynthetic gene cluster of Streptomyces violaceoruber Tu22 involved in the biosynthesis of L-rhodinose. (J Antibiot (Tokyo). , 2001)
Related Reference
ACC
O33708
NITE
Adria_00200
PmId
[9209071] Cloning and characterization of the Streptomyces peucetius dnmZUV genes encoding three enzymes required for biosynthesis of the daunorubicin precursor thymidine diphospho-L-daunosamine. (J Bacteriol. , 1997)
[10631513] A two-plasmid system for the glycosylation of polyketide antibiotics: bioconversion of epsilon-rhodomycinone to rhodomycin D. (Chem Biol. , 1999)
[9447597] Production of the antitumor drug epirubicin (4'-epidoxorubicin) and its precursor by a genetically engineered strain of Streptomyces peucetius. (Nat Biotechnol. , 1998)

close this sectionSequence

selected fasta
>putative NDP-hexose C-4 ketoreductase [putative dTDP4-keto-6-deoxyhexose reductase]
MPHPTPAPRVLVLGGSGFVGRHVCAAFLARGWEVHGWARHDRGAPGVTTRAVDLVRAEPG
RLADELAAVAPDTVVNASGAVWGVTETEMADANQALVSRVLTALGAAPSPRFVQLGTVHE
HTAATAYGRTKAAATARVLAAGGTVLRLPNLLGPGTPEGSFLGRVGAQLARAARTGEAVT
VTTLAVRERREFLDVRDAADAVLAAAAPAAARRVRGRALDLATGCPVGVRELLDALIRIS
GVPARVEERLPDPGWAPPGGLEGVGAGAAGPDEAARLLGWRAVRGPEESLRGLWETAVSL
PAGL
selected fasta
>putative NDP-hexose C-4 ketoreductase [putative dTDP4-keto-6-deoxyhexose reductase]
ATGCCGCACCCCACCCCCGCGCCCCGCGTGCTCGTTCTCGGCGGCAGCGGTTTCGTCGGC
CGCCATGTGTGTGCCGCGTTCCTGGCACGGGGCTGGGAGGTGCACGGCTGGGCGAGGCAC
GACCGGGGGGCACCGGGCGTCACGACGCGCGCCGTCGACCTGGTGCGTGCCGAGCCCGGA
CGGCTCGCGGACGAGCTGGCCGCGGTGGCGCCGGACACGGTCGTCAACGCTTCCGGTGCC
GTGTGGGGCGTGACGGAGACGGAGATGGCGGACGCCAACCAGGCCCTCGTCTCCCGGGTC
CTCACGGCGCTCGGCGCCGCACCGTCGCCCCGTTTCGTCCAGCTCGGTACCGTGCACGAA
CACACGGCGGCGACCGCCTACGGACGGACCAAGGCGGCCGCCACCGCGCGGGTCCTGGCG
GCGGGCGGTACCGTGCTGCGGCTGCCGAACCTGCTGGGGCCCGGCACCCCCGAGGGCAGT
TTCCTGGGGCGCGTCGGCGCGCAGCTCGCCCGGGCCGCGCGCACCGGCGAGGCGGTGACC
GTGACGACGCTCGCCGTGCGCGAGCGCCGCGAGTTCCTGGACGTACGGGACGCCGCCGAC
GCGGTGCTCGCCGCGGCCGCCCCCGCCGCCGCCCGGCGCGTGCGGGGCCGGGCGCTCGAC
CTGGCGACCGGCTGCCCCGTCGGCGTACGGGAGCTGCTCGACGCGTTGATCCGGATAAGT
GGCGTGCCCGCGCGCGTGGAGGAGCGGCTCCCGGACCCGGGATGGGCACCTCCTGGTGGC
CTGGAGGGGGTGGGCGCCGGAGCGGCCGGTCCCGACGAGGCGGCGCGGCTGCTGGGCTGG
CGTGCGGTGCGCGGCCCCGAGGAGTCGCTGCGCGGACTGTGGGAGACCGCGGTGAGTCTT
CCAGCGGGCCTCTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001509 NAD-dependent epimerase/dehydratase (Domain)
 [10-207]  1e-22 PF01370
PF01370   Epimerase
IPR016040 NAD(P)-binding domain (Domain)
 [9-156]  6.1e-16 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP
 [1-25]  0.384 Signal
Bacteria, Gram-positive   
 [1-25]  0.897 Signal
Eukaryota   
TMHMM No significant hit