close all open/close all

CDS information : Grana_00180


close this sectionLocation

Organism
StrainTü22
Entry nameGranaticin
Contig
Start / Stop / Direction22,245 / 21,004 / - [in whole cluster]
22,245 / 21,004 / - [in contig]
Locationcomplement(21004..22245) [in whole cluster]
complement(21004..22245) [in contig]
TypeCDS
Length1,242 bp (413 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.3 uncharacterized protein (biosynthesis involved)
Producthypothetical protein
Product (GenBank)
Gene
Gene (GenBank)gra-orf24
EC number
Keyword
  • L-rhodinose
Note
Note (GenBank)
Reference
ACC
PmId
[9831526] The granaticin biosynthetic gene cluster of Streptomyces violaceoruber Tu22: sequence analysis and expression in a heterologous host. (Chem Biol. , 1998)
[11269719] Identification of four genes from the granaticin biosynthetic gene cluster of Streptomyces violaceoruber Tu22 involved in the biosynthesis of L-rhodinose. (J Antibiot (Tokyo). , 2001)

close this sectionSequence

selected fasta
>hypothetical protein
MKLLFVAPVVGTHGEVTTGLGLARLLAPAGITAHFVVDTHNAPQLEAAGVPGTLIDASMG
VGVRKVVEDVVRAERPDVVVLSDYLSYWLMMHRVYRTDPWFVERLGVPVIPLDLYEWENT
DFRIDHFGLDLEVDRRILDMPVQLRPAPWARPDPGPGSRALTYPFMRPLPRPTAEARRTV
RSSLGLRDGERLLSLSVSGWQRYAQTVEDPTTRGLAHRVPERVAAALRRLPPTTRFLVVG
PDLDGLEGLPAERTHRVPACPPDRYQELLDASDAVLSLHVPASALVRSVFSDLPAVYIGH
SGPPADGPVGPGEPDGPGRPDRPDGPDALAPYSMWPLRWNSVIRPLLTDNPLSETFRRTE
LLDPEGTVAALDAVLHDPAERTRLAEGRARYLAALDALPAVPEIFTEAVRRLG
selected fasta
>hypothetical protein
ATGAAGCTGCTGTTCGTCGCACCCGTCGTCGGCACCCACGGCGAGGTCACCACCGGGCTT
GGCCTGGCCCGGCTGCTCGCCCCCGCCGGGATCACCGCCCACTTCGTCGTGGACACCCAC
AACGCCCCGCAGCTCGAGGCCGCGGGCGTACCCGGCACCCTGATCGACGCGTCGATGGGA
GTCGGGGTCCGCAAGGTCGTCGAGGACGTCGTACGGGCCGAGCGGCCCGATGTGGTCGTG
CTCAGCGACTACCTCTCGTACTGGTTGATGATGCACCGCGTCTACCGAACCGACCCCTGG
TTCGTGGAACGGCTCGGCGTCCCGGTGATCCCGCTCGACCTGTACGAGTGGGAGAACACC
GACTTCCGCATCGACCACTTCGGGCTCGACCTGGAGGTGGACCGGCGGATCCTCGACATG
CCCGTCCAGCTGCGGCCCGCGCCGTGGGCGCGTCCCGACCCGGGCCCCGGCAGCCGAGCC
CTGACCTACCCCTTCATGCGGCCGCTGCCCCGCCCCACCGCCGAGGCGCGCCGCACCGTG
CGGAGCTCCCTCGGGCTGCGGGACGGGGAACGCCTCCTCTCGCTGTCCGTCTCGGGCTGG
CAGCGGTACGCCCAGACCGTCGAGGACCCGACGACCCGCGGGCTCGCCCACCGGGTGCCG
GAGCGGGTCGCGGCGGCGCTGCGCAGGCTTCCCCCCACCACCCGGTTCCTCGTCGTCGGG
CCTGATCTGGACGGTCTGGAAGGGCTGCCGGCCGAGCGCACCCACCGTGTGCCGGCCTGC
CCGCCCGACCGCTACCAGGAGCTCCTCGACGCCTCGGACGCCGTGCTGTCGCTGCACGTG
CCCGCCTCGGCGCTGGTCCGCTCGGTCTTCTCGGACCTGCCCGCGGTGTACATCGGCCAC
AGCGGCCCGCCCGCGGACGGACCGGTTGGCCCGGGCGAGCCGGACGGGCCGGGCAGGCCA
GACAGGCCGGACGGGCCGGACGCACTGGCCCCGTACAGCATGTGGCCGCTGCGCTGGAAC
TCCGTCATCCGGCCACTGCTCACCGACAACCCCCTGTCCGAGACCTTCCGGCGGACCGAA
CTCCTCGACCCCGAAGGGACGGTGGCGGCACTCGACGCCGTGCTCCACGATCCGGCCGAG
CGCACCCGGCTGGCCGAGGGACGCGCCCGCTATCTGGCGGCGCTCGACGCGCTGCCCGCC
GTGCCCGAGATCTTCACGGAGGCGGTCCGCCGGCTGGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP
 [1-14]  0.958 Signal
Eukaryota   
TMHMM No significant hit