close all open/close all

CDS information : Grana_00190


close this sectionLocation

Organism
StrainTü22
Entry nameGranaticin
Contig
Start / Stop / Direction22,829 / 22,242 / - [in whole cluster]
22,829 / 22,242 / - [in contig]
Locationcomplement(22242..22829) [in whole cluster]
complement(22242..22829) [in contig]
TypeCDS
Length588 bp (195 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose epimerase
Product (GenBank)putative dTDP-4-keto-6-deoxyglucose-2,3-dehydratase
Gene
Gene (GenBank)gra-orf25
EC number5.1.3.-
Keyword
  • L-rhodinose
Note
Note (GenBank)
Reference
ACC
PmId
[9831526] The granaticin biosynthetic gene cluster of Streptomyces violaceoruber Tu22: sequence analysis and expression in a heterologous host. (Chem Biol. , 1998)
[11269719] Identification of four genes from the granaticin biosynthetic gene cluster of Streptomyces violaceoruber Tu22 involved in the biosynthesis of L-rhodinose. (J Antibiot (Tokyo). , 2001)
Related Reference
ACC
Q9S0P2
NITE
Aver_00150
PmId
[11451669] Insights about the biosynthesis of the avermectin deoxysugar L-oleandrose through heterologous expression of Streptomyces avermitilis deoxysugar genes in Streptomyces lividans. (Chem Biol. , 2001)

close this sectionSequence

selected fasta
>putative NDP-hexose epimerase [putative dTDP-4-keto-6-deoxyglucose-2,3-dehydratase]
MDIQELREVPGAYVITPRQWPDPRGTFFESLRTDLVSEAVGRPFEVRQINYSTSRRNTLR
GVHGVLIPPGQAKYVTCVRGALRDMVVDLRVGSPTFGQSASTLLTPENGVAVHVAEGLGH
GFLALTDDTCISYALSTAHVPGTQFEIDPLDPDLALPWGFDEPPLLSAKDAGAPSLRTAL
ERGILPRWLGRIGTP
selected fasta
>putative NDP-hexose epimerase [putative dTDP-4-keto-6-deoxyglucose-2,3-dehydratase]
ATGGACATCCAAGAGCTCCGGGAGGTCCCGGGCGCGTACGTGATCACCCCGCGCCAGTGG
CCGGACCCGCGCGGCACGTTCTTCGAGTCGCTCCGCACCGACCTCGTCAGCGAAGCCGTC
GGCCGCCCTTTCGAAGTGCGGCAGATCAACTACTCGACCTCGCGCCGCAACACGCTGCGT
GGCGTCCACGGCGTGCTGATTCCGCCCGGCCAGGCCAAGTACGTCACCTGTGTGCGAGGC
GCGCTGCGCGACATGGTCGTGGACCTGCGGGTCGGATCACCCACCTTCGGGCAGAGCGCG
AGCACCCTGCTCACCCCGGAGAACGGAGTGGCCGTCCACGTCGCGGAGGGCCTCGGCCAC
GGCTTCCTCGCGCTCACCGACGACACCTGCATCTCCTACGCCCTGTCCACCGCGCATGTG
CCGGGCACCCAGTTCGAGATCGACCCGCTCGACCCCGACCTGGCTCTCCCCTGGGGATTC
GACGAGCCACCGCTGCTGTCCGCGAAGGACGCCGGGGCTCCATCGCTGCGCACCGCTCTG
GAGCGGGGCATCCTGCCGCGCTGGCTCGGAAGGATCGGGACACCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000888 dTDP-4-dehydrorhamnose 3,5-epimerase-related (Family)
 [8-177]  6.19999999999995e-47 PF00908
PF00908   dTDP_sugar_isom
 [9-179]  PD001462
PD001462   dTDP_sugar_isom
IPR011051 RmlC-like cupin domain (Domain)
 [1-183]  1.90000694315261e-63 SSF51182
SSF51182   RmlC_like_cupin
IPR014710 RmlC-like jelly roll fold (Domain)
 [8-186]  4.10000000000004e-53 G3DSA:2.60.120.10
G3DSA:2.60.120.10   RmlC-like_jellyroll
SignalP No significant hit
TMHMM No significant hit