close all open/close all

CDS information : Grana_00200


close this sectionLocation

Organism
StrainTü22
Entry nameGranaticin
Contig
Start / Stop / Direction23,872 / 22,844 / - [in whole cluster]
23,872 / 22,844 / - [in contig]
Locationcomplement(22844..23872) [in whole cluster]
complement(22844..23872) [in contig]
TypeCDS
Length1,029 bp (342 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
ProductdTDP-hexose C-3 ketoreductase
Product (GenBank)
Gene
Gene (GenBank)gra-orf26
EC number
Keyword
  • D-olivose
  • L-rhodinose
Note
Note (GenBank)
Reference
ACC
PmId
[9831526] The granaticin biosynthetic gene cluster of Streptomyces violaceoruber Tu22: sequence analysis and expression in a heterologous host. (Chem Biol. , 1998)

close this sectionSequence

selected fasta
>dTDP-hexose C-3 ketoreductase
MNAGHTETVRALRIGVAGCADIALRRMLPAFAASPHTEPTAVASRSSEKARAAAETFGCA
AVEGYDALLERRDVDAVYIPLPVALHAPWTERALRAGKHVLAEKPLTARAADTARLLDLA
RERGLVLAENYLFVHHSAYTAVRDLVDAGAIGDVRALSASFTIPPRSADDIRYRADLDGG
ALLDIGVYPLRLASLLLGSELRVRGAVLRHDTVRGVDLGGSALLGDPGTGVSAQLVFGME
HAYTAGWRLLGSEGSLTLDRAYSPPAGHRPVLRIERPDGTEERILPAHDQATAAVAAFAE
AVRRAGQGAGQDKGRSSGDAAAVLRQAELVDAVRQAAHLVKI
selected fasta
>dTDP-hexose C-3 ketoreductase
GTGAACGCGGGGCACACCGAAACGGTGAGGGCGCTGCGGATCGGGGTCGCGGGCTGTGCC
GACATCGCGCTGCGCCGGATGCTGCCCGCCTTCGCCGCCTCCCCGCACACGGAGCCGACG
GCCGTCGCCAGCCGCAGCTCCGAGAAGGCGCGGGCCGCCGCCGAGACCTTCGGGTGCGCG
GCCGTCGAGGGGTACGACGCCCTCCTCGAACGCCGCGACGTGGACGCCGTGTACATCCCG
CTGCCGGTCGCCCTGCACGCCCCCTGGACCGAGCGCGCCCTGCGCGCGGGCAAGCACGTC
CTCGCTGAGAAGCCGCTGACCGCGCGGGCGGCCGACACCGCACGCCTGCTGGACCTCGCC
CGCGAACGCGGCCTCGTCCTCGCCGAGAACTATCTGTTCGTCCACCACTCCGCCTACACG
GCCGTACGGGACCTGGTGGACGCCGGTGCGATCGGTGATGTGCGGGCGCTGAGCGCCTCG
TTCACCATCCCGCCGCGCTCCGCGGACGACATCCGCTACCGCGCGGACCTCGACGGCGGC
GCGCTCCTCGACATCGGCGTGTACCCGCTCCGGCTGGCCTCTTTGCTGCTCGGCTCCGAG
CTGCGGGTGCGCGGGGCCGTCCTGCGCCACGACACCGTGCGCGGTGTCGACCTCGGCGGC
AGCGCGTTGCTCGGCGACCCCGGCACCGGCGTCAGCGCCCAACTTGTCTTCGGCATGGAG
CACGCCTACACGGCGGGCTGGCGGCTCCTGGGCAGCGAGGGCAGCCTCACCCTCGACCGG
GCGTACTCGCCCCCCGCCGGCCACCGCCCGGTCCTGCGCATCGAGCGTCCGGACGGCACC
GAGGAGCGGATCCTTCCCGCACACGACCAGGCGACCGCCGCCGTCGCCGCCTTCGCCGAA
GCCGTCCGCCGGGCCGGGCAGGGCGCCGGCCAGGACAAGGGCCGGAGCTCGGGCGACGCG
GCGGCGGTGCTCCGCCAGGCCGAGCTGGTCGACGCCGTCCGGCAGGCAGCCCATCTCGTG
AAGATCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000683 Oxidoreductase, N-terminal (Domain)
 [12-131]  1.2e-26 PF01408
PF01408   GFO_IDH_MocA
IPR004104 Oxidoreductase, C-terminal (Domain)
 [143-248]  1.4e-07 PF02894
PF02894   GFO_IDH_MocA_C
IPR016040 NAD(P)-binding domain (Domain)
 [8-153]  5.79999999999997e-44 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP
 [1-32]  0.421 Signal
Bacteria, Gram-negative   
 [1-32]  0.52 Signal
Bacteria, Gram-positive   
TMHMM No significant hit