close all open/close all

CDS information : Grana_00210


close this sectionLocation

Organism
StrainTü22
Entry nameGranaticin
Contig
Start / Stop / Direction25,200 / 23,869 / - [in whole cluster]
25,200 / 23,869 / - [in contig]
Locationcomplement(23869..25200) [in whole cluster]
complement(23869..25200) [in contig]
TypeCDS
Length1,332 bp (443 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
ProductdTDP-4-keto-6-deoxy-D-glucose 2,3-dehydratase
Product (GenBank)putative dTDP-4-keto-6-deoxyglucose-3,5-epimerase
Gene
Gene (GenBank)gra-orf27
EC number
Keyword
  • D-olivose
  • L-rhodinose
Note
Note (GenBank)
Reference
ACC
PmId
[9831526] The granaticin biosynthetic gene cluster of Streptomyces violaceoruber Tu22: sequence analysis and expression in a heterologous host. (Chem Biol. , 1998)

close this sectionSequence

selected fasta
>dTDP-4-keto-6-deoxy-D-glucose 2,3-dehydratase [putative dTDP-4-keto-6-deoxyglucose-3,5-epimerase]
MRITDTAGFHAWFAERGAAHRYRITRTPLHDLEGWYTDPASGDVRHRSGRFFSIEGLRYG
RQEPDGPAWTQPIIRQPETGVLGVLIKWFDGVPHLLMQAKMEPGNINTLQVSPTVQATFS
NYTRVHHGSPVRYIDHFLTPGAGDRVHYDALQSEQGSWFLGKRNRNIVVETTGEIPVHED
FCWVPRPVMAELLRVDNLVNMDSRTVLAGLPDDPGEGSVPRRAVEKPLHDTAALLHWFTG
AKVRHRPERTTIPLSRVGGWRRDDDRGEIVHETGRYFRIIGVDVEADSREVTSWSQPMLA
PVGRGVVAFVSKEIHGERHLLVQARAEAGTFDAVELGPTVQCNPGNLPDGAPRPPYLDTV
LTARPEQVLFDTVHSEEGGRFYHAENRYLVLDGDDVPVDVPEDYTWMTVRQLTRAGRIGN
LVDVEARTLLACVRTLPDHGASR
selected fasta
>dTDP-4-keto-6-deoxy-D-glucose 2,3-dehydratase [putative dTDP-4-keto-6-deoxyglucose-3,5-epimerase]
ATGCGAATCACGGACACGGCCGGCTTCCATGCCTGGTTCGCCGAGCGGGGCGCGGCCCAC
CGCTACCGCATCACCCGGACGCCGCTGCACGACCTGGAGGGCTGGTACACCGACCCGGCG
AGCGGCGATGTCCGCCACCGCAGCGGGCGGTTCTTCTCCATCGAGGGTCTGCGGTACGGA
CGGCAGGAACCTGACGGGCCCGCATGGACGCAGCCGATCATCCGGCAGCCCGAGACGGGC
GTCCTGGGCGTGCTGATCAAGTGGTTCGACGGGGTTCCGCATCTGCTGATGCAGGCCAAG
ATGGAGCCGGGCAACATCAACACGCTCCAGGTCTCGCCGACCGTGCAGGCCACGTTCAGC
AACTACACACGGGTCCACCACGGTTCCCCCGTGCGCTATATCGACCACTTCCTCACACCG
GGGGCCGGGGACCGGGTCCACTACGACGCGCTGCAGAGCGAGCAGGGATCGTGGTTCCTG
GGCAAGCGCAACCGCAACATCGTCGTGGAGACGACCGGGGAGATCCCGGTACACGAGGAC
TTCTGCTGGGTGCCGCGTCCGGTGATGGCGGAGCTGCTGCGCGTCGACAACCTCGTCAAC
ATGGACTCGCGCACCGTGCTGGCCGGTCTGCCGGACGATCCCGGCGAGGGCTCCGTGCCG
AGGCGGGCGGTGGAGAAGCCGCTGCACGACACCGCGGCGCTGCTGCACTGGTTCACCGGA
GCCAAGGTGCGGCACCGTCCCGAGCGCACGACGATCCCGCTGAGTCGGGTCGGCGGCTGG
CGCCGCGACGACGACCGGGGTGAGATCGTCCATGAGACGGGCCGGTACTTCCGGATCATC
GGCGTCGATGTCGAGGCCGACAGCCGCGAGGTGACGTCCTGGTCGCAGCCGATGCTGGCG
CCGGTCGGCCGGGGAGTGGTCGCCTTCGTCAGCAAGGAGATCCACGGGGAACGCCATCTC
CTGGTGCAGGCCCGCGCGGAGGCGGGGACCTTCGACGCCGTCGAGCTGGGACCCACCGTG
CAGTGCAACCCGGGCAACCTGCCCGACGGCGCACCCCGGCCGCCCTACCTGGACACCGTC
CTGACCGCACGGCCCGAGCAGGTGCTCTTCGACACCGTCCACTCCGAGGAGGGCGGCCGG
TTCTACCACGCGGAGAACCGCTACCTCGTCCTGGACGGAGACGACGTGCCCGTCGACGTA
CCCGAGGACTACACCTGGATGACGGTCCGCCAGCTCACCCGCGCCGGCCGGATCGGCAAC
CTCGTCGACGTGGAGGCGCGCACCCTGCTGGCGTGCGTCCGCACCCTGCCCGACCACGGA
GCATCCCGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005212 NDP-hexose 2,3-dehydratase (Domain)
 [5-210]  3.79999999999991e-77 PF03559 [229-433]  1.29999999999998e-75 PF03559
PF03559   Hexose_dehydrat
SignalP
 [1-19]  0.164 Signal
Eukaryota   
TMHMM No significant hit