close all open/close all

CDS information : Grana_00230


close this sectionLocation

Organism
StrainTü22
Entry nameGranaticin
Contig
Start / Stop / Direction27,124 / 26,093 / - [in whole cluster]
27,124 / 26,093 / - [in contig]
Locationcomplement(26093..27124) [in whole cluster]
complement(26093..27124) [in contig]
TypeCDS
Length1,032 bp (343 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative oxidoreductase
Product (GenBank)putative FMN-dependent monooxygenase
Gene
Gene (GenBank)gra-orf29
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[9831526] The granaticin biosynthetic gene cluster of Streptomyces violaceoruber Tu22: sequence analysis and expression in a heterologous host. (Chem Biol. , 1998)
Related Reference
ACC
Q8TXY4
PmId
[1953299] Purification and properties of N5,N10-methylenetetrahydromethanopterin reductase (coenzyme F420-dependent) from the extreme thermophile Methanopyrus kandleri. (Arch Microbiol. , 1991)
Family/Domain
FD
IPR011251

close this sectionSequence

selected fasta
>putative oxidoreductase [putative FMN-dependent monooxygenase]
MRLAVNLVHQGAGELARAAERSGYAAALAPEGYRSDAASVLGLVAGVTERIALISGVMQI
PGRPPAMTALTAATLDSLSGGRFRLGLGVSNPDVSVGWYGVPFARPLERTREYVDIVRRA
LEGDPVTYQGTHFEVGGPAPLHLLTERRPGRLPVLLAAVGPRNLRLAGEIADGWLGVFTS
PEAVAESVAEIRKGRGTDDLDGFEVLPSLPTAVADSAQDAADMLRGQYVYLMGIGDPDRN
FYCAMARSMGYEAEVAAFLERLAAGDRTGAGAALPLGFIDRTALIGPVDRIADRMRAYAD
AGVTTLGVMVSAAATGLEGRLAIVEAAARALERSGTATTAGTG
selected fasta
>putative oxidoreductase [putative FMN-dependent monooxygenase]
GTGCGGCTCGCCGTGAACCTCGTCCACCAGGGTGCCGGCGAACTCGCCCGCGCCGCCGAG
CGGTCGGGCTACGCCGCCGCCCTCGCCCCGGAGGGATACCGGTCCGACGCGGCCAGTGTC
CTCGGGCTGGTGGCAGGGGTCACCGAACGCATCGCGCTGATCTCGGGTGTGATGCAGATC
CCGGGCCGCCCGCCGGCCATGACCGCGCTGACCGCCGCCACGCTCGACTCGCTGAGCGGC
GGCCGCTTCCGGCTCGGGCTCGGGGTGTCCAACCCCGACGTGTCGGTGGGCTGGTACGGC
GTGCCGTTCGCCCGGCCGCTGGAGCGCACCAGGGAGTACGTCGACATCGTCCGGCGCGCC
CTGGAGGGCGACCCTGTCACCTACCAGGGCACTCACTTCGAGGTCGGCGGGCCCGCCCCG
CTGCATCTGCTGACCGAGCGGCGGCCCGGCCGGCTGCCGGTGCTGCTCGCGGCGGTCGGT
CCGCGCAACCTGCGGCTCGCGGGGGAGATCGCGGACGGCTGGCTCGGCGTCTTCACCTCC
CCCGAAGCCGTGGCCGAGTCCGTCGCGGAGATCCGCAAGGGCCGGGGCACCGACGACCTG
GACGGCTTCGAGGTGCTGCCCAGCCTGCCCACCGCCGTCGCCGACAGCGCGCAGGATGCG
GCGGACATGCTGCGCGGCCAGTACGTGTACCTGATGGGCATCGGCGATCCCGACCGCAAC
TTCTACTGCGCGATGGCCCGTTCGATGGGCTACGAGGCCGAGGTCGCCGCCTTCCTGGAG
CGGCTCGCCGCCGGTGACCGCACGGGCGCAGGGGCCGCACTGCCCCTCGGTTTCATCGAC
CGTACGGCGCTGATCGGCCCGGTCGACCGGATCGCCGACCGGATGCGCGCCTACGCCGAC
GCGGGCGTGACCACCCTCGGGGTCATGGTCTCGGCCGCCGCGACCGGCCTGGAAGGGCGA
CTGGCGATCGTCGAAGCGGCGGCCCGCGCACTGGAGCGCTCCGGCACCGCCACCACCGCC
GGCACCGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR011251 Luciferase-like domain (Domain)
 [1-331]  1.90000694315261e-62 SSF51679
SSF51679   Luciferase_like
 [13-304]  1.69999999999998e-67 PF00296
PF00296   Bac_luciferase
 [13-329]  2.99999999999998e-66 G3DSA:3.20.20.30
G3DSA:3.20.20.30   Luciferase_like
SignalP No significant hit
TMHMM No significant hit