close all open/close all

CDS information : Grana_00240


close this sectionLocation

Organism
StrainTü22
Entry nameGranaticin
Contig
Start / Stop / Direction27,951 / 27,202 / - [in whole cluster]
27,951 / 27,202 / - [in contig]
Locationcomplement(27202..27951) [in whole cluster]
complement(27202..27951) [in contig]
TypeCDS
Length750 bp (249 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
ProductC-3 ketoreductase
Product (GenBank)
Gene
Gene (GenBank)gra-orf6
EC number
Keyword
  • R-stereochemistry
Note
Note (GenBank)
Reference
ACC
PmId
[2583128] Structure and deduced function of the granaticin-producing polyketide synthase gene cluster of Streptomyces violaceoruber Tu22. (EMBO J. , 1989)
[9831526] The granaticin biosynthetic gene cluster of Streptomyces violaceoruber Tu22: sequence analysis and expression in a heterologous host. (Chem Biol. , 1998)
[1400167] Functional replacement of genes for individual polyketide synthase components in Streptomyces coelicolor A3(2) by heterologous genes from a different polyketide pathway. (J Bacteriol. , 1992)
[11325954] Functional complementation of pyran ring formation in actinorhodin biosynthesis in Streptomyces coelicolor A3(2) by ketoreductase genes for granaticin biosynthesis. (J Bacteriol. , 2001)
[11707113] A new mode of stereochemical control revealed by analysis of the biosynthesis of dihydrogranaticin in Streptomyces violaceoruber Tu22. (J Am Chem Soc. , 2001)
Related Reference
ACC
Q65YY6
PmId
[15498668] Remarkably different structures and reaction mechanisms of ketoreductases for the opposite stereochemical control in the biosynthesis of BIQ antibiotics. (Bioorg Med Chem. , 2004)
Conflict
Sequence
SNGGHRAQT (160..168)
Comment
conflict with Q65YY6 (SKAAIEHMT)

close this sectionSequence

selected fasta
>C-3 ketoreductase
MATDAPEAPVALVTGSSSGIGQTVAQRLAAEGYRVVVNSARSVEDGEKTAAALPDALYVR
ADVSEEADARRLVDTAVEHYGRLDVLVNNAGRTRAIPHADLAAATPEVWREILGLNVIGT
WQTTVAAMPHLARSGNGSVVNVSSIAGSRPAGSSIPYAVSNGGHRAQTRLLANTVGPAVR
VNAVAPGLIETPWTQNSDFFAPIAEHVRQTTPLRRTGRPEDVAEAVLGLVRATYTTGQVL
LVDGGAHLL
selected fasta
>C-3 ketoreductase
ATGGCCACCGACGCGCCCGAGGCGCCTGTCGCCCTGGTCACCGGTTCCTCCTCCGGCATC
GGGCAGACCGTCGCCCAGCGGCTGGCCGCCGAGGGGTACCGGGTGGTCGTCAACTCGGCC
CGCTCCGTGGAGGACGGCGAGAAGACGGCCGCCGCACTGCCCGACGCGCTCTACGTCCGG
GCGGACGTCTCCGAGGAGGCGGACGCCCGCCGTCTGGTGGACACCGCCGTGGAGCACTAC
GGCCGACTGGACGTCCTCGTCAACAACGCCGGCCGGACCCGCGCCATCCCGCACGCCGAC
CTGGCGGCCGCCACCCCCGAGGTGTGGCGGGAGATCCTCGGTCTGAACGTCATCGGCACC
TGGCAGACCACCGTCGCCGCGATGCCTCACCTCGCCCGCTCGGGGAACGGCTCCGTCGTC
AACGTGTCGTCGATCGCGGGGAGCCGCCCGGCCGGCAGCTCGATCCCTTACGCGGTGAGC
AATGGCGGCCATCGAGCACAGACTCGGCTCCTCGCCAACACGGTGGGTCCGGCTGTGCGC
GTCAACGCGGTCGCGCCGGGGCTGATCGAGACGCCGTGGACGCAGAACAGCGACTTCTTC
GCACCGATCGCCGAGCACGTGCGGCAGACGACGCCACTGCGCCGGACAGGCAGGCCGGAA
GACGTCGCGGAAGCCGTCCTCGGGCTGGTCCGCGCCACGTACACCACCGGGCAGGTCCTG
CTCGTGGACGGCGGCGCCCACCTCCTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [10-172]  1.2e-29 PF00106
PF00106   adh_short
 [81-92]  1.49999977583352e-07 PR00080 [137-145]  1.49999977583352e-07 PR00080 [157-176]  1.49999977583352e-07 PR00080
PR00080   SDRFAMILY
IPR002347 Glucose/ribitol dehydrogenase (Family)
 [10-27]  4.30000170645869e-37 PR00081 [81-92]  4.30000170645869e-37 PR00081 [131-147]  4.30000170645869e-37 PR00081 [157-176]  4.30000170645869e-37 PR00081 [177-194]  4.30000170645869e-37 PR00081 [212-232]  4.30000170645869e-37 PR00081
PR00081   GDHRDH
IPR016040 NAD(P)-binding domain (Domain)
 [9-248]  5.40000000000002e-73 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP
 [1-29]  0.274 Signal
Bacteria, Gram-positive   
TMHMM No significant hit