close all open/close all

CDS information : Grana_00250


close this sectionLocation

Organism
StrainTü22
Entry nameGranaticin
Contig
Start / Stop / Direction28,769 / 27,951 / - [in whole cluster]
28,769 / 27,951 / - [in contig]
Locationcomplement(27951..28769) [in whole cluster]
complement(27951..28769) [in contig]
TypeCDS
Length819 bp (272 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productpolyketide C-9 ketoreductase
Product (GenBank)polyketide ketoreductase
Gene
Gene (GenBank)gra-orf5
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[2583128] Structure and deduced function of the granaticin-producing polyketide synthase gene cluster of Streptomyces violaceoruber Tu22. (EMBO J. , 1989)
[9831526] The granaticin biosynthetic gene cluster of Streptomyces violaceoruber Tu22: sequence analysis and expression in a heterologous host. (Chem Biol. , 1998)
[1400167] Functional replacement of genes for individual polyketide synthase components in Streptomyces coelicolor A3(2) by heterologous genes from a different polyketide pathway. (J Bacteriol. , 1992)
Related Reference
ACC
P16544
NITE
Actino_00170
PmId
[2394677] Biosynthesis of anthraquinones by interspecies cloning of actinorhodin biosynthesis genes in streptomycetes: clarification of actinorhodin gene functions. (J Bacteriol. , 1990)
[15458634] The crystal structure of the actIII actinorhodin polyketide reductase: proposed mechanism for ACP and polyketide binding. (Structure. , 2004)
[18205400] Inhibition kinetics and emodin cocrystal structure of a type II polyketide ketoreductase. (Biochemistry. , 2008)
[18691223] Localization of the ActIII actinorhodin polyketide ketoreductase to the cell wall. (FEMS Microbiol Lett. , 2008)

close this sectionSequence

selected fasta
>polyketide C-9 ketoreductase [polyketide ketoreductase]
MTTATATATATPGTAAKPVALVTGATSGIGLAIARRLAALGARTFLCARDEERLAQTVKE
LRGEGFDVDGTVCDVADPAQIRAYVAAAVQRYGTVDILVNNAGRSGGGATAEIADELWLD
VITTNLTSVFLMTKEVLNAGGMLAKKRGRIINIASTGGKQGVVHAVPYSASKHGVVGLTK
ALGLELARTGITVNAVCPGFVETPMAERVREHYAGIWQVSEEETFDRITNRVPLGRYVET
REVAAMVEYLVADDAAAVTAQALNVCGGLGNY
selected fasta
>polyketide C-9 ketoreductase [polyketide ketoreductase]
ATGACGACGGCGACAGCGACGGCCACGGCCACCCCCGGCACGGCGGCGAAGCCGGTGGCG
CTGGTGACCGGTGCCACCAGCGGCATCGGGCTTGCGATCGCCCGCCGGCTGGCCGCGCTC
GGCGCGCGCACCTTCCTGTGCGCCCGGGACGAGGAGCGGCTGGCGCAGACGGTGAAGGAG
CTGCGCGGCGAGGGGTTCGACGTCGACGGCACGGTGTGCGACGTGGCGGATCCGGCCCAG
ATCCGCGCCTACGTGGCGGCGGCCGTCCAGCGGTACGGCACGGTCGACATCCTGGTGAAC
AACGCCGGCCGCAGCGGCGGCGGCGCCACCGCCGAAATCGCCGACGAGCTCTGGCTCGAC
GTCATCACCACCAACCTGACCAGCGTCTTCCTCATGACGAAGGAAGTGCTCAACGCGGGC
GGGATGCTCGCCAAGAAGCGTGGGCGGATCATCAACATCGCCTCCACCGGCGGCAAGCAG
GGCGTCGTGCACGCGGTGCCGTACTCGGCGTCCAAGCACGGCGTCGTCGGGCTGACCAAG
GCCCTCGGCCTGGAGCTGGCCCGTACCGGCATCACCGTGAACGCGGTGTGCCCGGGCTTC
GTGGAGACCCCGATGGCCGAGCGGGTGCGCGAGCACTACGCGGGCATCTGGCAGGTCTCC
GAGGAGGAGACGTTCGACCGCATCACCAACCGGGTGCCGCTGGGCCGGTACGTGGAGACC
CGCGAGGTGGCCGCGATGGTCGAGTACCTGGTGGCGGACGACGCGGCGGCGGTCACCGCG
CAGGCGCTGAACGTCTGCGGCGGGCTGGGCAACTACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [93-104]  3.00000067992871e-14 PR00080 [148-156]  3.00000067992871e-14 PR00080 [168-187]  3.00000067992871e-14 PR00080
PR00080   SDRFAMILY
 [4-264]  8.49999291746323e-27 PIRSF000126
PIRSF000126   11-beta-HSD1
 [19-186]  1.99999999999999e-38 PF00106
PF00106   adh_short
IPR002347 Glucose/ribitol dehydrogenase (Family)
 [19-36]  2.99998750445706e-47 PR00081 [93-104]  2.99998750445706e-47 PR00081 [142-158]  2.99998750445706e-47 PR00081 [168-187]  2.99998750445706e-47 PR00081 [189-206]  2.99998750445706e-47 PR00081 [233-253]  2.99998750445706e-47 PR00081
PR00081   GDHRDH
IPR016040 NAD(P)-binding domain (Domain)
 [17-269]  6.90000000000007e-81 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR020904 Short-chain dehydrogenase/reductase, conserved site (Conserved_site)
 [155-183]  PS00061
PS00061   ADH_SHORT
SignalP
 [1-34]  0.432 Signal
Bacteria, Gram-positive   
 [1-16]  0.88 Signal
Eukaryota   
TMHMM No significant hit