close all open/close all

CDS information : Grana_00260


close this sectionLocation

Organism
StrainTü22
Entry nameGranaticin
Contig
Start / Stop / Direction29,038 / 30,303 / + [in whole cluster]
29,038 / 30,303 / + [in contig]
Location29038..30303 [in whole cluster]
29038..30303 [in contig]
TypeCDS
Length1,266 bp (421 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase beta-ketoacyl synthase subunit
Product (GenBank)polyketide synthase keto-acyl synthase
Gene
Gene (GenBank)gra-orf1
EC number
Keyword
  • type II PKS
Note
Note (GenBank)
Reference
ACC
PmId
[2583128] Structure and deduced function of the granaticin-producing polyketide synthase gene cluster of Streptomyces violaceoruber Tu22. (EMBO J. , 1989)
[9831526] The granaticin biosynthetic gene cluster of Streptomyces violaceoruber Tu22: sequence analysis and expression in a heterologous host. (Chem Biol. , 1998)
[1400167] Functional replacement of genes for individual polyketide synthase components in Streptomyces coelicolor A3(2) by heterologous genes from a different polyketide pathway. (J Bacteriol. , 1992)
Related Reference
ACC
Q02059
NITE
Actino_00180
PmId
[10519556] A chain initiation factor common to both modular and aromatic polyketide synthases. (Nature. , 1999)
[10684659] Mechanistic analysis of a type II polyketide synthase. Role of conserved residues in the beta-ketoacyl synthase-chain length factor heterodimer. (Biochemistry. , 2000)
[15286722] An antibiotic factory caught in action. (Nat Struct Mol Biol. , 2004)
[18034463] Dissecting the component reactions catalyzed by the actinorhodin minimal polyketide synthase. (Biochemistry. , 2007)

close this sectionPKS/NRPS Module

KS3..375

close this sectionSequence

selected fasta
>polyketide synthase beta-ketoacyl synthase subunit [polyketide synthase keto-acyl synthase]
MTRRVVITGVGVRAPGGSGTKEFWDLLTAGRTATRPISFFDASPFRSRIAGEIDFDAVAE
GFSPREVRRMDRATQFAVACTRDALADSGLDTGALDPSRIGVALGSAVASATSLENEYLV
MSDSGREWLVDPAHLSPMMFDYLSPGVMPAEVAWAAGAEGPVTMVSDGCTSGLDSVGYAV
QGTREGSADVVVAGAADTPVSPIVVACFDAIKATTPRNDDPAHASRPFDGTRNGFVLAEG
AAMFVLEEYEAAQRRGAHIYAEVGGYATRSQAYHMTGLKKDGREMAESIRAALDEARLDR
TAVDYVNAHGSGTKQNDRHETAAFKRSLGEHAYAVPVSSIKSMGGHSLGAIGSIEIAASV
LAIEHNVVPPTANLHTPDPECDLDYVPLTAREQRVDTVLTVGSGFGGFQSAMVLHRPEEA
A
selected fasta
>polyketide synthase beta-ketoacyl synthase subunit [polyketide synthase keto-acyl synthase]
GTGACCCGACGCGTAGTGATCACCGGGGTCGGGGTGCGTGCCCCTGGCGGCTCAGGGACG
AAGGAGTTCTGGGACCTGCTCACCGCCGGCCGCACGGCGACTCGACCCATCAGTTTCTTC
GACGCCTCCCCGTTCCGCTCGCGGATCGCGGGGGAGATCGACTTCGACGCCGTCGCGGAG
GGCTTCTCCCCGCGTGAGGTCCGTCGCATGGACCGCGCCACCCAGTTCGCGGTCGCCTGC
ACCCGGGACGCGCTGGCCGACAGCGGCCTGGACACGGGCGCCCTCGACCCGTCCCGGATC
GGCGTCGCCCTGGGGAGCGCGGTCGCGTCGGCGACGAGCCTGGAGAACGAGTACCTGGTG
ATGTCGGACTCCGGCCGCGAGTGGCTGGTGGACCCGGCACACCTGTCGCCGATGATGTTC
GACTACCTCAGCCCGGGCGTCATGCCCGCCGAGGTCGCCTGGGCGGCCGGCGCGGAGGGC
CCGGTCACCATGGTCTCCGACGGCTGCACCTCGGGCCTGGACTCGGTCGGCTACGCCGTT
CAGGGGACCCGCGAGGGCAGCGCGGACGTGGTGGTCGCCGGCGCCGCCGACACCCCCGTC
TCCCCGATCGTGGTGGCCTGCTTCGACGCCATCAAGGCGACGACCCCGCGCAACGACGAC
CCGGCGCACGCCTCCCGGCCCTTCGACGGCACCCGCAACGGCTTCGTCCTCGCCGAGGGC
GCCGCCATGTTCGTCCTGGAGGAGTACGAGGCCGCCCAGCGACGCGGAGCCCACATCTAC
GCCGAGGTCGGCGGCTACGCCACGCGCTCGCAAGCGTACCACATGACGGGTCTGAAGAAG
GACGGCCGGGAGATGGCCGAATCGATCAGGGCCGCACTCGACGAGGCCCGGCTGGACCGT
ACGGCGGTCGACTACGTCAACGCGCACGGCTCCGGCACCAAGCAGAACGACCGCCACGAG
ACGGCCGCCTTCAAGCGCAGCCTCGGCGAGCACGCGTACGCGGTGCCCGTCAGCTCCATC
AAATCCATGGGGGGGCACTCACTCGGCGCGATCGGCTCCATCGAGATCGCAGCGTCGGTC
CTCGCCATCGAACACAACGTCGTCCCGCCGACGGCGAATCTGCACACCCCCGACCCCGAG
TGCGACCTGGACTACGTTCCGCTCACCGCGCGCGAGCAGCGCGTCGACACGGTGCTCACC
GTGGGCAGCGGCTTCGGCGGGTTCCAGAGCGCCATGGTCCTGCACCGCCCGGAGGAGGCC
GCGTGA
KS3..375
KS7..1125

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [3-251]  4.80000000000003e-59 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [260-375]  3.2e-36 PF02801
PF02801   Ketoacyl-synt_C
IPR016038 Thiolase-like, subgroup (Domain)
 [3-263]  1.20000000000001e-66 G3DSA:3.40.47.10 [270-418]  7.79999999999999e-52 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [2-257]  1.69998802370953e-68 SSF53901 [219-418]  2.60000517657733e-62 SSF53901
SSF53901   Thiolase-like
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [160-176]  PS00606
PS00606   B_KETOACYL_SYNTHASE
SignalP No significant hit
TMHMM No significant hit