close all open/close all

CDS information : Grana_00290


close this sectionLocation

Organism
StrainTü22
Entry nameGranaticin
Contig
Start / Stop / Direction32,006 / 32,980 / + [in whole cluster]
32,006 / 32,980 / + [in contig]
Location32006..32980 [in whole cluster]
32006..32980 [in contig]
TypeCDS
Length975 bp (324 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative cyclase/dehydratase
Product (GenBank)aromatase
Gene
Gene (GenBank)gra-orf4
EC number
Keyword
  • 1st ring
Note
Note (GenBank)
Reference
ACC
PmId
[2583128] Structure and deduced function of the granaticin-producing polyketide synthase gene cluster of Streptomyces violaceoruber Tu22. (EMBO J. , 1989)
[9831526] The granaticin biosynthetic gene cluster of Streptomyces violaceoruber Tu22: sequence analysis and expression in a heterologous host. (Chem Biol. , 1998)
[1400167] Functional replacement of genes for individual polyketide synthase components in Streptomyces coelicolor A3(2) by heterologous genes from a different polyketide pathway. (J Bacteriol. , 1992)
Related Reference
ACC
Q9X464
NITE
Naphcy_00040
PmId
[10206788] Isolation and characterization of the naphthocyclinone gene cluster from Streptomyces arenae DSM 40737 and heterologous expression of the polyketide synthase genes. (Gene. , 1999)
ACC
Q02055
NITE
Actino_00210
PmId
[11851466] Genetic Contributions to Understanding Polyketide Synthases. (Chem Rev. , 1997)

close this sectionSequence

selected fasta
>putative cyclase/dehydratase [aromatase]
MVQPAATPVSLPSPTVHRSEHTVTVAAPPEALYALVADVTRWPAVFEPTVHVRHLAREGR
TERFEIWAEVNGEIAHWRSRRVLDPVRRYVSFRQEHSRPPVTSMSGGWLFRPLADGRTEI
VLRHRFTVADDDPAAVARIEEALDRNSARELGALAALAETGHPVDELVFSFTDTLPLQGA
ARDAYTFVERAERWAELLPHVAQCGADRAGTGLEQWLEMDTVTADGSTHTTRSARICRAP
EWIAYNEQRTPRLVSGHSGEWTFAQTPEGPVATARHTVAVDPSGITEVLGPDATLADARA
YLRDALGRNSLATLRHAAEAAQRA
selected fasta
>putative cyclase/dehydratase [aromatase]
ATGGTCCAGCCCGCCGCCACCCCCGTCTCCCTGCCCAGCCCCACCGTCCACCGCAGCGAG
CACACCGTGACGGTGGCCGCACCGCCCGAGGCGCTCTACGCGCTCGTCGCCGACGTGACG
CGGTGGCCGGCCGTGTTCGAGCCGACGGTGCACGTGCGGCACCTCGCCCGGGAGGGGCGG
ACCGAACGGTTCGAGATCTGGGCCGAGGTGAACGGCGAGATCGCGCACTGGCGTTCGCGC
CGCGTTCTCGACCCGGTGCGGCGGTACGTGTCGTTCCGTCAGGAGCACAGCCGGCCGCCG
GTGACCTCGATGTCCGGAGGGTGGCTGTTCCGCCCGCTGGCCGACGGCCGGACGGAGATC
GTGCTGCGGCACCGGTTCACCGTCGCCGACGACGACCCGGCCGCCGTGGCCCGTATCGAG
GAGGCCCTCGACCGCAACAGCGCCCGAGAACTGGGCGCGCTCGCGGCGCTCGCCGAGACC
GGGCACCCGGTGGACGAACTGGTCTTCTCCTTCACGGACACCCTCCCGCTCCAGGGCGCC
GCCCGGGACGCGTACACCTTCGTCGAGCGTGCCGAGCGCTGGGCCGAGCTGCTGCCGCAC
GTCGCCCAATGTGGTGCTGACCGAGCCGGAACCGGGCTCGAGCAGTGGCTGGAGATGGAC
ACCGTGACGGCCGACGGGTCCACCCACACCACCAGGTCGGCGCGCATCTGCCGGGCGCCC
GAGTGGATCGCGTACAACGAGCAGCGCACCCCCCGGCTCGTGTCCGGCCACAGCGGCGAG
TGGACGTTCGCCCAGACCCCCGAGGGTCCCGTGGCGACCGCCCGCCACACCGTCGCCGTC
GACCCGAGCGGCATCACCGAGGTCCTCGGCCCGGACGCCACCCTCGCCGACGCCCGGGCC
TACCTCCGCGACGCCCTGGGCCGCAACAGCCTGGCCACGCTGCGGCACGCCGCCGAAGCG
GCCCAGCGGGCGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR019587 Polyketide cyclase/dehydrase (Family)
 [17-159]  5.20000000000001e-13 PF10604
PF10604   Polyketide_cyc2
IPR023393 START-like domain (Domain)
 [19-129]  1.3e-14 G3DSA:3.30.530.20
G3DSA:3.30.530.20   G3DSA:3.30.530.20
SignalP
 [1-33]  0.074 Signal
Bacteria, Gram-negative   
TMHMM No significant hit