close all open/close all

CDS information : Grana_00300


close this sectionLocation

Organism
StrainTü22
Entry nameGranaticin
Contig
Start / Stop / Direction33,856 / 33,008 / - [in whole cluster]
33,856 / 33,008 / - [in contig]
Locationcomplement(33008..33856) [in whole cluster]
complement(33008..33856) [in contig]
TypeCDS
Length849 bp (282 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)
Gene
Gene (GenBank)gra-orf30
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[9831526] The granaticin biosynthetic gene cluster of Streptomyces violaceoruber Tu22: sequence analysis and expression in a heterologous host. (Chem Biol. , 1998)
Related Reference
ACC
Q93IZ2
NITE
Actino_00090
PmId
[1766437] Organisation and functions of the actVA region of the actinorhodin biosynthetic gene cluster of Streptomyces coelicolor. (Mol Gen Genet. , 1991)
ACC
B6SEG3
NITE
Alnu_00180
PmId
[22474343] Biosynthetic pathway toward carbohydrate-like moieties of alnumycins contains unusual steps for C-C bond formation and cleavage. (Proc Natl Acad Sci U S A. , 2012)

close this sectionSequence

selected fasta
>hypothetical protein
MSGVGADVDRLFEDDFQEDWAAPGRAARWRLRPLPWLARGDGRVGTPGDGCGLCVESGYG
GVGVGERPAFTRAPGGREGEAHLRWAAFAEPEARVPGPFRAEAELSARVFGADRHPDGDG
PRCAMAALICVDMASGLALDFALTNGFVWVLYERLPRPGAAHGSFAYAVPVAPRTPEAWH
RCAVEVDPSAGRARWLLDGEEVFAVDRTGLELDAGRHGRHLERSTPGPRTEVAPDRLAFG
LGLLATTAYGQGVRLRARRAALSAGAGTTTAAALTSRRGTGR
selected fasta
>hypothetical protein
GTGAGTGGAGTGGGGGCGGACGTGGACAGGCTGTTCGAGGACGATTTCCAGGAGGACTGG
GCGGCGCCGGGGCGGGCGGCCCGCTGGCGGCTGCGGCCGCTGCCGTGGCTGGCGCGGGGC
GACGGCCGGGTGGGGACGCCCGGCGACGGGTGCGGGCTGTGCGTGGAGTCCGGGTACGGC
GGCGTGGGGGTGGGGGAGCGGCCCGCGTTCACCCGGGCACCGGGGGGGCGGGAGGGTGAG
GCCCACCTGCGGTGGGCGGCGTTCGCGGAGCCCGAGGCGCGGGTGCCCGGGCCGTTCCGG
GCGGAGGCGGAGCTGTCGGCGCGGGTCTTCGGCGCGGACCGGCATCCGGACGGGGACGGG
CCGCGGTGCGCCATGGCCGCGCTGATCTGCGTGGACATGGCCTCCGGCCTGGCCCTCGAC
TTCGCCCTGACGAACGGCTTCGTGTGGGTACTGTACGAGCGGCTGCCCCGGCCCGGCGCG
GCGCACGGCTCGTTCGCGTACGCCGTACCGGTGGCTCCCCGCACCCCCGAGGCATGGCAT
CGCTGTGCGGTTGAGGTGGATCCGTCGGCGGGCCGGGCCCGCTGGCTACTGGACGGCGAG
GAGGTGTTCGCGGTCGACCGGACGGGCCTGGAGCTCGACGCCGGCCGCCACGGCCGCCAT
CTGGAGCGTTCCACCCCCGGCCCGCGCACCGAGGTGGCGCCGGACCGCCTCGCATTCGGC
CTCGGACTGCTCGCCACGACGGCGTACGGGCAGGGGGTCCGGCTGCGCGCCAGGCGCGCG
GCGCTGAGTGCGGGGGCGGGGACGACCACGGCGGCTGCCCTGACCTCCCGCCGGGGCACG
GGGCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP No significant hit
TMHMM No significant hit