close all open/close all

CDS information : Grana_00310


close this sectionLocation

Organism
StrainTü22
Entry nameGranaticin
Contig
Start / Stop / Direction33,991 / 34,419 / + [in whole cluster]
33,991 / 34,419 / + [in contig]
Location33991..34419 [in whole cluster]
33991..34419 [in contig]
TypeCDS
Length429 bp (142 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)
Gene
Gene (GenBank)gra-orf31
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[9831526] The granaticin biosynthetic gene cluster of Streptomyces violaceoruber Tu22: sequence analysis and expression in a heterologous host. (Chem Biol. , 1998)
Related Reference
ACC
Q53925
NITE
Actino_00020
PmId
[17227452] Possible involvement of ActVI-ORFA in transcriptional regulation of actVI tailoring-step genes for actinorhodin biosynthesis. (FEMS Microbiol Lett. , 2007)

close this sectionSequence

selected fasta
>hypothetical protein
MTATAVRTDVYAQVQHFYAHQMQALDGGRFADYAATFTEDGTFQHSPSAAPAVGRAGIVA
ELVEFNKRFDGDPVQRRHWFNHIALEPQADGSLRSTVYALVVTVRPGGKPEIAPSCVVHD
VLVVTDEGVRTRSRLVTHDQLA
selected fasta
>hypothetical protein
GTGACCGCCACCGCAGTCCGTACCGATGTCTACGCCCAGGTCCAGCACTTCTACGCCCAC
CAGATGCAGGCCCTCGACGGGGGTCGCTTCGCCGACTACGCGGCCACGTTCACGGAGGAC
GGCACCTTCCAGCACTCCCCCTCCGCCGCGCCGGCGGTGGGCCGGGCCGGGATCGTCGCC
GAACTGGTGGAATTCAACAAGCGCTTCGACGGCGACCCGGTCCAGCGGCGTCACTGGTTC
AACCACATCGCCCTGGAGCCCCAGGCCGACGGCTCGCTGCGCTCCACCGTGTACGCCCTG
GTCGTCACCGTCCGCCCCGGCGGGAAGCCGGAGATCGCCCCCAGCTGTGTCGTCCACGAC
GTCCTCGTCGTCACGGACGAGGGCGTACGGACCCGTTCCCGCCTGGTCACCCACGACCAG
CTGGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002075 Nuclear transport factor 2 (Domain)
 [14-130]  1.7e-14 PF02136
PF02136   NTF2
SignalP
 [1-12]  0.209 Signal
Bacteria, Gram-negative   
TMHMM No significant hit