close all open/close all

CDS information : Grana_00320


close this sectionLocation

Organism
StrainTü22
Entry nameGranaticin
Contig
Start / Stop / Direction34,530 / 35,258 / + [in whole cluster]
34,530 / 35,258 / + [in contig]
Location34530..35258 [in whole cluster]
34530..35258 [in contig]
TypeCDS
Length729 bp (242 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Productputative phosphopantetheinyl transferase
Product (GenBank)
Gene
Gene (GenBank)gra-orf32
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[9831526] The granaticin biosynthetic gene cluster of Streptomyces violaceoruber Tu22: sequence analysis and expression in a heterologous host. (Chem Biol. , 1998)
Related Reference
ACC
P39135
PmId
[9484229] Characterization of Sfp, a Bacillus subtilis phosphopantetheinyl transferase for peptidyl carrier protein domains in peptide synthetases. (Biochemistry. , 1998)
ACC
Q9L7M4
NITE
Jado_00180
PmId
[11390684] Cloning and functional analysis of a phosphopantetheinyl transferase superfamily gene associated with jadomycin biosynthesis in Streptomyces venezuelae ISP5230. (Microbiology. , 2001)
Family/Domain
FD
IPR008278

close this sectionSequence

selected fasta
>putative phosphopantetheinyl transferase
MIHGSVERWAQAAEARGTVPLGRPYPGDDAERLRTLRDEALRRRFVASRLIVRSVLGVLV
GRDPDRIRLTRTALGRPYAPDLPELDFSLSHTGSLLAVAVVRGGRVGVDAERQGRPMSVL
EHRMCTPHERAVLDGRGLRGTARDRELLCLWTRKEAYTKALGTGLRRPARTFGLDAADPA
GRPVLRDAAGAPLPGGWTAITHTLSETGAETVLSVVAAFRRPPPPSTPNRGEPVAFEPGS
SR
selected fasta
>putative phosphopantetheinyl transferase
GTGATCCACGGCAGCGTCGAACGGTGGGCGCAGGCGGCCGAGGCCCGGGGCACGGTGCCG
CTCGGCCGCCCGTACCCCGGCGACGACGCGGAACGTCTGCGCACCCTGCGCGACGAGGCC
CTGCGCCGGCGTTTCGTCGCCTCCCGGCTGATCGTGCGCAGCGTCCTCGGCGTGCTCGTG
GGCCGCGACCCGGACCGGATCCGCCTCACCCGCACCGCGCTGGGCCGCCCTTACGCCCCC
GACCTGCCGGAACTGGACTTCAGCCTCAGCCACACCGGCTCCCTGCTCGCCGTCGCGGTG
GTACGCGGCGGCCGCGTCGGCGTCGACGCCGAACGGCAGGGGCGTCCCATGTCCGTACTG
GAGCACCGGATGTGCACGCCCCACGAGCGCGCCGTACTCGACGGGCGCGGGCTGCGCGGG
ACCGCGCGGGACCGGGAGTTGCTGTGCCTGTGGACGCGCAAGGAGGCGTACACCAAGGCC
CTCGGTACGGGACTGCGCCGGCCGGCCCGCACTTTCGGTCTGGACGCCGCCGATCCGGCG
GGGCGGCCCGTGCTGCGGGACGCGGCCGGCGCCCCGCTGCCCGGCGGCTGGACCGCCATC
ACACACACTCTGAGCGAGACAGGTGCGGAGACGGTGCTCAGCGTGGTCGCGGCCTTCCGC
CGCCCGCCTCCGCCCTCGACCCCGAACCGGGGGGAGCCGGTGGCGTTCGAGCCGGGCTCC
AGCCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR008278 4'-phosphopantetheinyl transferase (Domain)
 [2-110]  3.49999466863949e-19 SSF56214 [104-239]  1.39999892049878e-16 SSF56214
SSF56214   4-PPT_transf
 [106-202]  1.6e-09 G3DSA:3.90.470.20
G3DSA:3.90.470.20   G3DSA:3.90.470.20
 [105-176]  1.6e-09 PF01648
PF01648   ACPS
SignalP No significant hit
TMHMM No significant hit