close all open/close all

CDS information : Grana_00330


close this sectionLocation

Organism
StrainTü22
Entry nameGranaticin
Contig
Start / Stop / Direction35,302 / 36,267 / + [in whole cluster]
35,302 / 36,267 / + [in contig]
Location35302..36267 [in whole cluster]
35302..36267 [in contig]
TypeCDS
Length966 bp (321 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative cyclase/dehydratase
Product (GenBank)cyclase
Gene
Gene (GenBank)gra-orf33
EC number
Keyword
  • 2nd ring
Note
Note (GenBank)
Reference
ACC
PmId
[2583128] Structure and deduced function of the granaticin-producing polyketide synthase gene cluster of Streptomyces violaceoruber Tu22. (EMBO J. , 1989)
[9831526] The granaticin biosynthetic gene cluster of Streptomyces violaceoruber Tu22: sequence analysis and expression in a heterologous host. (Chem Biol. , 1998)
Related Reference
ACC
Q9X466
NITE
Naphcy_00060
PmId
[10206788] Isolation and characterization of the naphthocyclinone gene cluster from Streptomyces arenae DSM 40737 and heterologous expression of the polyketide synthase genes. (Gene. , 1999)
ACC
Q93IZ0
NITE
Actino_00220
PmId
[11851466] Genetic Contributions to Understanding Polyketide Synthases. (Chem Rev. , 1997)

close this sectionSequence

selected fasta
>putative cyclase/dehydratase [cyclase]
MTGVTTATAVGATEGAAGGGATGRRPELTEVADGVFAYVQPDGGWCLNNAGLILSGDRAA
LVDTAATETRARGLREAVLSVAPTAPQVLVNTHFHGDHTFGNFVFPEALVVGHERARTEM
TEAGLHLTGLWPDVEWGALALVPPALTFRDRLTLHIGDKAAEVLHLGPAHTSNDTVVWLP
AERVLFTGDLVMNGVTPFCPMGSVAGSLEALDTMRALAPEVVVTGHGPVAGPGVFDETEA
YLRLLQDLARQGLAEKLDPVALARCTDLGRYARWLDAERLVPNLFRAYAEEQGEPRGSRV
DMSELFRRMVEYHGGLPTCHA
selected fasta
>putative cyclase/dehydratase [cyclase]
ATGACCGGAGTGACCACCGCGACGGCCGTCGGAGCGACCGAGGGCGCGGCCGGCGGGGGA
GCGACCGGCCGCCGGCCCGAGCTGACGGAGGTCGCCGACGGGGTGTTCGCCTACGTCCAG
CCGGACGGAGGCTGGTGCCTGAACAACGCCGGCCTGATCCTCTCGGGCGACCGTGCCGCG
CTCGTCGACACCGCGGCGACCGAGACGCGGGCCCGGGGGCTGCGCGAGGCGGTGCTCTCC
GTCGCCCCGACCGCCCCGCAGGTCCTGGTGAACACTCACTTCCACGGCGACCACACCTTC
GGCAACTTCGTCTTCCCGGAGGCGCTCGTCGTCGGCCACGAACGCGCCCGCACGGAGATG
ACCGAGGCGGGCCTGCATCTGACGGGCCTGTGGCCGGACGTCGAGTGGGGTGCGCTGGCA
CTCGTCCCGCCGGCCCTGACCTTCCGCGACCGGCTCACCCTGCACATCGGCGACAAGGCC
GCCGAGGTGCTCCACCTCGGTCCGGCGCACACGAGCAACGACACCGTGGTCTGGCTGCCC
GCCGAGCGGGTGCTGTTCACCGGCGACCTGGTGATGAACGGGGTGACGCCGTTCTGCCCC
ATGGGCTCGGTCGCCGGCTCCCTGGAGGCGCTGGACACGATGCGCGCCCTCGCCCCCGAG
GTGGTCGTCACCGGCCACGGACCGGTCGCGGGGCCCGGGGTGTTCGACGAGACCGAGGCA
TATCTGCGCCTGCTCCAGGATCTCGCCCGACAGGGTCTCGCCGAGAAGCTCGACCCCGTC
GCGCTGGCCCGCTGTACCGACCTGGGCCGGTACGCGCGGTGGCTGGACGCCGAGCGGCTC
GTCCCCAACCTCTTCCGGGCGTACGCCGAGGAACAGGGCGAGCCCCGCGGTTCCCGCGTG
GACATGAGCGAGCTGTTCCGGCGCATGGTGGAGTACCACGGCGGGCTCCCCACCTGCCAC
GCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001279 Beta-lactamase-like (Domain)
 [47-226]  3.00000067992871e-32 SM00849
SM00849   Lactamase_B
 [44-226]  6.60000000000002e-22 PF00753
PF00753   Lactamase_B
SignalP No significant hit
TMHMM No significant hit