close all open/close all

CDS information : Grana_00340


close this sectionLocation

Organism
StrainTü22
Entry nameGranaticin
Contig
Start / Stop / Direction36,818 / 36,279 / - [in whole cluster]
36,818 / 36,279 / - [in contig]
Locationcomplement(36279..36818) [in whole cluster]
complement(36279..36818) [in contig]
TypeCDS
Length540 bp (179 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative NADH-dependent FMN reductase
Product (GenBank)putative FMN:NADH oxidoreductase
Gene
Gene (GenBank)gra-orf34
EC number1.5.1.42
Keyword
  • two-component system
  • C-6 quinone formation
  • C-8 hydroxylate
Note
Note (GenBank)
Reference
ACC
PmId
[9831526] The granaticin biosynthetic gene cluster of Streptomyces violaceoruber Tu22: sequence analysis and expression in a heterologous host. (Chem Biol. , 1998)
Related Reference
ACC
Q02058
NITE
Actino_00230
PmId
[7615536] Identification of a flavin:NADH oxidoreductase involved in the biosynthesis of actinorhodin. Purification and characterization of the recombinant enzyme. (J Biol Chem. , 1995)
[18245777] Mechanism and regulation of the Two-component FMN-dependent monooxygenase ActVA-ActVB from Streptomyces coelicolor. (J Biol Chem. , 2008)
[19246012] Biosynthesis of actinorhodin and related antibiotics: discovery of alternative routes for quinone formation encoded in the act gene cluster. (Chem Biol. , 2009)
[22086671] Epoxyquinone formation catalyzed by a two-component flavin-dependent monooxygenase involved in biosynthesis of the antibiotic actinorhodin. (Chembiochem. , 2011)

close this sectionSequence

selected fasta
>putative NADH-dependent FMN reductase [putative FMN:NADH oxidoreductase]
MEPEAFRDFFGSVPTAVAVVTTVGADGRPLGFTCNAFSAVSLDPALLLVCVDERSRTLPA
LLGSEVFALHLLAAEGGEELARTFAGRSDRKFDGLAWRHGESVPGSPVLREGVLAHAECA
LESSVRAGDHRLLIGRMERVLVREEARPLLYRRGAFTAWEAPVAETAVEAVTARVGARA
selected fasta
>putative NADH-dependent FMN reductase [putative FMN:NADH oxidoreductase]
GTGGAGCCCGAGGCATTCCGCGACTTCTTCGGATCGGTACCGACGGCCGTCGCGGTGGTG
ACCACGGTCGGCGCCGACGGCAGACCGCTCGGGTTCACCTGCAACGCCTTCAGCGCGGTC
TCTCTGGACCCGGCCCTGTTGCTGGTCTGCGTGGACGAGCGGTCCCGCACGCTGCCCGCG
TTGCTCGGCTCGGAGGTCTTCGCGCTGCACCTGCTGGCCGCCGAGGGCGGCGAGGAGCTG
GCGCGGACCTTCGCGGGGCGCTCGGACCGGAAGTTCGACGGGCTGGCGTGGCGGCACGGC
GAGTCCGTGCCGGGCTCCCCGGTGCTGCGCGAGGGGGTGCTGGCGCACGCGGAGTGCGCG
CTGGAGAGCAGCGTCCGGGCAGGTGACCACCGGCTGCTGATCGGACGCATGGAGCGGGTC
CTGGTACGCGAGGAGGCCCGCCCGCTGCTGTACCGGCGGGGGGCCTTCACCGCGTGGGAG
GCCCCCGTCGCCGAAACGGCCGTCGAAGCGGTCACCGCCCGGGTCGGGGCGCGGGCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002563 Flavin reductase-like, FMN-binding (Domain)
 [11-159]  7.10000000000008e-35 PF01613
PF01613   Flavin_Reduct
 [10-158]  9.60004130884281e-45 SM00903
SM00903   Flavin_Reduct
IPR009002 FMN-binding split barrel-related (Domain)
 [1-167]  8.59998776239544e-42 SSF50475
SSF50475   FMN_binding
IPR012349 FMN-binding split barrel (Domain)
 [5-162]  4.9e-48 G3DSA:2.30.110.10
G3DSA:2.30.110.10   PNPOx_FMN_bd
SignalP
 [1-25]  0.201 Signal
Bacteria, Gram-positive   
 [1-18]  0.193 Signal
Eukaryota   
TMHMM No significant hit