close all open/close all

CDS information : Grana_00350


close this sectionLocation

Organism
StrainTü22
Entry nameGranaticin
Contig
Start / Stop / Direction37,004 / 37,471 / + [in whole cluster]
37,004 / 37,471 / + [in contig]
Location37004..37471 [in whole cluster]
37004..37471 [in contig]
TypeCDS
Length468 bp (155 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)
Gene
Gene (GenBank)gra-orf35
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in granaticin biosynthesis.
Note (GenBank)
Reference
ACC
PmId
[9831526] The granaticin biosynthetic gene cluster of Streptomyces violaceoruber Tu22: sequence analysis and expression in a heterologous host. (Chem Biol. , 1998)

close this sectionSequence

selected fasta
>hypothetical protein
MLFQVRTARSVTSLATATREVGRSGGVVLASCVVVAVTAAGLGPWATVAVLTPGAALQVA
AGTRHSAGSWQIGFASPGRPDRAVSGLLRRGRPGREDLGPLLVTTLLVAWGVPGWFVLGG
IFLLAAAATKPVARWAERARAAASASTHGEWATAQ
selected fasta
>hypothetical protein
ATGCTCTTTCAGGTCCGTACGGCCAGGTCGGTGACGAGTCTCGCGACGGCCACCCGCGAG
GTGGGCCGGTCCGGTGGCGTCGTGCTCGCCTCGTGCGTGGTCGTCGCCGTCACGGCGGCC
GGACTCGGGCCGTGGGCCACGGTCGCGGTGCTCACCCCCGGCGCGGCCCTCCAAGTCGCC
GCCGGGACGCGGCACTCCGCCGGGTCCTGGCAGATCGGATTCGCCTCGCCCGGCCGGCCG
GATCGGGCAGTATCGGGGCTTCTACGGCGCGGGCGTCCCGGTCGCGAGGACCTCGGCCCG
CTGCTCGTCACCACGCTCCTGGTGGCCTGGGGCGTGCCCGGCTGGTTCGTGCTCGGCGGC
ATCTTCCTGCTGGCGGCGGCCGCGACGAAACCCGTGGCGCGCTGGGCCGAGCGGGCACGG
GCGGCGGCCTCCGCATCCACCCACGGTGAGTGGGCGACGGCCCAATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP
 [1-39]  0.567 Signal
Eukaryota   
 [1-61]  0.718 Signal
Bacteria, Gram-positive   
TMHMM
 [21-43]  Transmembrane (i-o) [106-128]  Transmembrane (o-i)
Transmembrane 2