close all open/close all
Grana_00360 Grana_00360   last last

CDS information : Grana_00370


close this sectionLocation

Organism
StrainTü22
Entry nameGranaticin
Contig
Start / Stop / Direction38,839 / 38,066 / - [in whole cluster]
38,839 / 38,066 / - [in contig]
Locationcomplement(38066..38839) [in whole cluster]
complement(38066..38839) [in contig]
TypeCDS
Length774 bp (257 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)putative transcriptional activator
Gene
Gene (GenBank)gra-orf37
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in granaticin biosynthesis.
Note (GenBank)
Reference
ACC
PmId
[9831526] The granaticin biosynthetic gene cluster of Streptomyces violaceoruber Tu22: sequence analysis and expression in a heterologous host. (Chem Biol. , 1998)

close this sectionSequence

selected fasta
>hypothetical protein [putative transcriptional activator]
MTRMDGVRAATDSAKDSVLHAAEVVAPYASTAKEQAVTYAGSAKDHAALYAHEARVRLAP
KVTKAARRARVQARAQYDTRVAPLVPPRVDEAAHRAAVVTRKAARQAADYTVPRVEHAVA
ATGPVLDEAGSRSTAAWAALRGQVTPDEIRKIVRKHERRARAGRVAKGLAILGVLAGGAF
AAWKWWDKQANPDWLVEPPAATEIDEASESSSRTSPSPLSSVDGSGALDAEVEAKQAEAE
AEAQVEAESDAERDDRR
selected fasta
>hypothetical protein [putative transcriptional activator]
GTGACCCGGATGGACGGCGTGCGCGCCGCGACCGATTCGGCCAAGGACAGCGTGTTGCAC
GCCGCGGAAGTGGTGGCGCCCTATGCGAGCACGGCCAAGGAACAGGCCGTGACGTACGCG
GGCTCGGCCAAGGACCACGCCGCTCTCTACGCGCACGAAGCACGTGTCCGGCTCGCGCCG
AAGGTGACGAAGGCCGCTCGGCGGGCCCGTGTTCAAGCTCGTGCGCAGTACGACACCCGT
GTCGCACCGCTGGTACCGCCACGGGTCGACGAGGCCGCGCATCGCGCCGCGGTCGTGACC
CGCAAGGCCGCCCGTCAGGCGGCCGACTACACCGTTCCGCGCGTCGAGCACGCGGTCGCC
GCGACCGGTCCCGTTCTCGACGAGGCGGGGTCGCGCTCCACTGCCGCCTGGGCCGCGCTG
CGCGGGCAGGTGACACCGGACGAGATTCGGAAGATCGTGAGGAAGCACGAGCGTCGGGCC
AGGGCCGGACGCGTCGCCAAGGGTCTCGCCATCCTCGGCGTGCTGGCCGGCGGCGCCTTC
GCCGCCTGGAAGTGGTGGGACAAGCAGGCCAACCCGGACTGGCTCGTGGAGCCTCCTGCC
GCTACCGAGATCGATGAGGCGTCGGAATCGTCGTCCCGTACGTCACCGTCACCGCTGTCG
TCCGTCGACGGCAGTGGCGCTCTCGATGCCGAGGTGGAGGCCAAGCAGGCCGAAGCCGAG
GCGGAAGCCCAAGTGGAGGCCGAGTCCGACGCGGAGCGCGACGACCGTCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP
 [1-32]  0.128 Signal
Bacteria, Gram-positive   
TMHMM No significant hit
Grana_00360 Grana_00360   last last