close all open/close all
first first   Griseo_00020 Griseo_00020

CDS information : Griseo_00010


close this sectionLocation

Organism
StrainJP95
Entry nameGriseorhodin A
Contig
Start / Stop / Direction1,245 / 2,066 / + [in whole cluster]
1,245 / 2,066 / + [in contig]
Location1245..2066 [in whole cluster]
1245..2066 [in contig]
TypeCDS
Length822 bp (273 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative transcriptional regulator
Product (GenBank)putative transcriptional activator GrhR1
Gene
Gene (GenBank)grhR1
EC number
Keyword
  • SARP family
Note
Note (GenBank)
Reference
ACC
PmId
[12323376] A gene cluster from a marine Streptomyces encoding the biosynthesis of the aromatic spiroketal polyketide griseorhodin A. (Chem Biol. , 2002)
Related Reference
ACC
Q83X29
PmId
[12791134] The large linear plasmid pSLA2-L of Streptomyces rochei has an unusually condensed gene organization for secondary metabolism. (Mol Microbiol. , 2003)
[20378964] Regulation of lankamycin biosynthesis in Streptomyces rochei by two SARP genes, srrY and srrZ. (Biosci Biotechnol Biochem. , 2010)
ACC
Q9XCC4
PmId
[11985721] Differential roles of two SARP-encoding regulatory genes during tylosin biosynthesis. (Mol Microbiol. , 2002)
[16942604] Regulation of tylosin biosynthesis involving 'SARP-helper' activity. (Mol Microbiol. , 2006)

close this sectionSequence

selected fasta
>putative transcriptional regulator [putative transcriptional activator GrhR1]
MDIEILGSLLVSENGIPVMPTAPKVRQVLAILAFFAGQVVPIAVLTDELWAGRPPRSART
TLQTYVLQLRELITVALPAPGRGKKALTAKDILVTCPGGYLLNTRGGTSDVREFERLAGL
GYRAVGDGDHAEGARLLGASLALWRGAPFADVQLGKQLEMEAARLEESRLCALDQRIEAD
LRLGRHRELLAELTVLVSRYRTHENLCRQFMIALQRSGRWSDALEVYRKLRGTLSRELGL
EPSLALRQLQRSILLDHSQMTASDSVPRAVRAV
selected fasta
>putative transcriptional regulator [putative transcriptional activator GrhR1]
GTGGACATCGAAATACTGGGATCCCTGCTCGTGTCGGAGAACGGGATACCCGTCATGCCC
ACCGCGCCGAAGGTGCGGCAAGTGCTCGCGATCCTGGCGTTCTTCGCCGGGCAGGTCGTG
CCGATCGCCGTGCTGACGGACGAGTTGTGGGCCGGCAGGCCGCCGCGCAGCGCCCGTACG
ACCCTGCAGACGTACGTCCTCCAACTGCGCGAGCTGATCACCGTCGCGCTGCCGGCTCCC
GGTCGCGGCAAGAAGGCGCTGACCGCCAAGGACATCCTGGTGACGTGCCCGGGGGGCTAT
CTCCTCAACACCAGGGGCGGCACCAGCGACGTGCGGGAGTTCGAGAGGCTCGCGGGGCTC
GGCTACCGCGCCGTCGGCGACGGGGACCACGCGGAGGGGGCACGGCTGCTGGGGGCCTCC
CTCGCGCTCTGGCGCGGGGCGCCGTTCGCCGACGTGCAGCTGGGCAAGCAGTTGGAGATG
GAGGCCGCGCGCCTGGAGGAGAGCCGGCTGTGCGCGCTGGACCAGCGCATCGAGGCCGAT
CTGCGGCTGGGGCGGCACCGCGAGCTGCTCGCCGAACTGACCGTGCTCGTCAGTCGCTAC
CGCACCCACGAGAACCTGTGCCGCCAGTTCATGATCGCGCTGCAGCGCTCCGGGCGCTGG
AGCGACGCCCTGGAGGTCTACCGGAAGCTGCGCGGCACGCTCTCCCGCGAACTGGGCCTG
GAGCCCTCCCTCGCCCTCCGCCAGCTCCAGCGTTCGATCCTGCTGGACCACAGCCAGATG
ACGGCCTCCGACTCCGTTCCCCGCGCGGTCCGGGCGGTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001867 Signal transduction response regulator, C-terminal (Domain)
 [19-102]  1.3e-13 PF00486
PF00486   Trans_reg_C
 [15-102]  7.89999609889417e-07 SM00862
SM00862   Trans_reg_C
IPR005158 Bacterial transcriptional activator domain (Domain)
 [110-254]  1.40000000000001e-49 PF03704
PF03704   BTAD
 [109-254]  5.6999970878395e-47 SM01043
SM01043   BTAD
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [23-75]  0.00016 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016032 Signal transduction response regulator, C-terminal effector (Domain)
 [1-103]  6.49999377884395e-10 SSF46894
SSF46894   Bipartite_resp_reg_C-effector
SignalP No significant hit
TMHMM No significant hit
first first   Griseo_00020 Griseo_00020