close all open/close all

CDS information : Griseo_00020


close this sectionLocation

Organism
StrainJP95
Entry nameGriseorhodin A
Contig
Start / Stop / Direction2,296 / 3,117 / + [in whole cluster]
2,296 / 3,117 / + [in contig]
Location2296..3117 [in whole cluster]
2296..3117 [in contig]
TypeCDS
Length822 bp (273 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative transcriptional regulator
Product (GenBank)putative transcriptional activator GrhR2
Gene
Gene (GenBank)grhR2
EC number
Keyword
  • SARP family
Note
Note (GenBank)
Reference
ACC
PmId
[12323376] A gene cluster from a marine Streptomyces encoding the biosynthesis of the aromatic spiroketal polyketide griseorhodin A. (Chem Biol. , 2002)
Related Reference
ACC
P25047
NITE
Adria_00210
PmId
[1729206] Regulation of secondary metabolism in Streptomyces spp. and overproduction of daunorubicin in Streptomyces peucetius. (J Bacteriol. , 1992)
[7868593] Functional characterization and transcriptional analysis of the dnrR1 locus, which controls daunorubicin biosynthesis in Streptomyces peucetius. (J Bacteriol. , 1995)
[8971703] Purification and characterization of the DNA-binding protein DnrI, a transcriptional factor of daunorubicin biosynthesis in Streptomyces peucetius. (Mol Microbiol. , 1996)
[16545946] Feedback regulation of doxorubicin biosynthesis in Streptomyces peucetius. (Res Microbiol. , 2006)
[20529134] Modulation of dnrN expression by intracellular levels of DnrO and daunorubicin in Streptomyces peucetius. (FEMS Microbiol Lett. , 2010)
[20158521] Daunorubicin efflux in Streptomyces peucetius modulates biosynthesis by feedback regulation. (FEMS Microbiol Lett. , 2010)

close this sectionSequence

selected fasta
>putative transcriptional regulator [putative transcriptional activator GrhR2]
MRIRVLGPLNADVNGVSVVPSAGKPRQVLSLLALYPGQIMPVPTLMEEIWGAAPPVSALT
TLQTYILQLRRRLGTAMGPEAPHTAKDVLATRHGGYVLQIPADSTDVHAYERKVREGQAA
FEAGDDESAADTLREALALWQGPALVDVRCGPALSIEVLRLEESRLVTVERRIDADLRLG
RHCEISAELRDLTARHPHHEGLHSQAMVALYRSGRQAAALDLYRKLRVRLIEELGVEPSP
QMQRMHQAMLSVDPALDLATGPRRGSTFDLYAA
selected fasta
>putative transcriptional regulator [putative transcriptional activator GrhR2]
ATGAGGATCCGGGTTCTGGGACCGCTGAATGCCGACGTCAATGGTGTCTCCGTCGTTCCC
TCGGCGGGCAAACCACGCCAAGTCCTTTCCCTGCTCGCGCTGTACCCGGGGCAGATCATG
CCCGTGCCGACGCTGATGGAGGAGATCTGGGGCGCCGCCCCGCCCGTCAGCGCGCTGACC
ACGCTCCAGACCTACATACTCCAGCTGCGGCGCCGGCTCGGCACCGCCATGGGGCCCGAG
GCCCCGCACACCGCGAAGGACGTCCTCGCCACGCGGCACGGCGGGTACGTGCTCCAGATC
CCGGCGGACAGCACGGACGTGCACGCCTACGAGCGCAAGGTGCGGGAGGGGCAGGCGGCC
TTCGAGGCCGGTGACGACGAGAGCGCTGCCGACACGCTGCGGGAGGCGCTGGCGCTCTGG
CAGGGACCCGCGCTGGTCGACGTGCGCTGCGGCCCGGCGCTGAGCATCGAGGTGCTCCGG
CTGGAGGAGAGCAGGCTGGTGACGGTGGAGCGGCGCATCGACGCCGATCTGCGGCTGGGC
CGTCACTGCGAGATCAGCGCCGAACTGCGGGACCTGACGGCGCGCCACCCGCACCACGAG
GGGCTGCACTCGCAGGCCATGGTGGCCCTGTACCGGTCCGGCCGGCAGGCCGCGGCGCTG
GACCTCTACCGCAAGCTGCGGGTACGGCTCATCGAGGAGCTGGGCGTGGAGCCCTCGCCG
CAGATGCAGCGCATGCACCAGGCGATGCTCTCCGTGGACCCCGCGCTCGACCTGGCCACG
GGGCCCCGGCGCGGCTCGACGTTCGACCTGTACGCGGCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001867 Signal transduction response regulator, C-terminal (Domain)
 [15-98]  1.89999859865864e-09 SM00862
SM00862   Trans_reg_C
 [19-98]  3.39999999999999e-18 PF00486
PF00486   Trans_reg_C
IPR005158 Bacterial transcriptional activator domain (Domain)
 [105-250]  4.2e-54 PF03704
PF03704   BTAD
 [105-250]  7.2000271977897e-53 SM01043
SM01043   BTAD
IPR011990 Tetratricopeptide-like helical (Domain)
 [115-226]  7.3e-05 G3DSA:1.25.40.10
G3DSA:1.25.40.10   TPR-like_helical
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [24-101]  2.8e-08 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016032 Signal transduction response regulator, C-terminal effector (Domain)
 [1-99]  4.50000034739347e-13 SSF46894
SSF46894   Bipartite_resp_reg_C-effector
SignalP No significant hit
TMHMM No significant hit