close all open/close all

CDS information : Griseo_00040


close this sectionLocation

Organism
StrainJP95
Entry nameGriseorhodin A
Contig
Start / Stop / Direction4,323 / 4,583 / + [in whole cluster]
4,323 / 4,583 / + [in contig]
Location4323..4583 [in whole cluster]
4323..4583 [in contig]
TypeCDS
Length261 bp (86 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase acyl carrier protein subunit
Product (GenBank)putative acyl carrier protein GrhC
Gene
Gene (GenBank)grhC
EC number
Keyword
  • type II PKS
Note
Note (GenBank)
Reference
ACC
PmId
[12323376] A gene cluster from a marine Streptomyces encoding the biosynthesis of the aromatic spiroketal polyketide griseorhodin A. (Chem Biol. , 2002)
Related Reference
ACC
Q9X463
NITE
Naphcy_00030
PmId
[10206788] Isolation and characterization of the naphthocyclinone gene cluster from Streptomyces arenae DSM 40737 and heterologous expression of the polyketide synthase genes. (Gene. , 1999)
ACC
Q54219
NITE
Griseu_00030
PmId
[8169211] Cloning, sequencing, and analysis of the griseusin polyketide synthase gene cluster from Streptomyces griseus. (J Bacteriol. , 1994)
[9108302] Post-translational modification of heterologously expressed Streptomyces type II polyketide synthase acyl carrier proteins. (FEBS Lett. , 1997)
[9738947] Acylation of Streptomyces type II polyketide synthase acyl carrier proteins. (FEBS Lett. , 1998)

close this sectionPKS/NRPS Module

ACP30..77

close this sectionSequence

selected fasta
>polyketide synthase acyl carrier protein subunit [putative acyl carrier protein GrhC]
MQQLDLPTLIGLLRTSGGSDTHDLNGDVLDVAFADLGYDSLCLLQVTGVIERDAGVALDE
QVLEEAETPRQYIAAVNRVLSPQATA
selected fasta
>polyketide synthase acyl carrier protein subunit [putative acyl carrier protein GrhC]
ATGCAGCAGCTCGACCTTCCCACCCTGATCGGCCTCCTGCGGACCAGCGGGGGCAGCGAC
ACCCACGACCTGAACGGGGACGTGCTGGACGTCGCGTTCGCCGATCTCGGCTACGACTCC
CTGTGCCTCCTCCAGGTCACCGGCGTCATCGAGCGCGATGCGGGGGTCGCGCTCGACGAG
CAGGTGCTGGAGGAGGCGGAGACCCCGAGGCAGTACATCGCGGCCGTCAACCGGGTGCTG
TCTCCGCAGGCCACCGCCTGA
ACP30..77
ACP88..231

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR009081 Acyl carrier protein-like (Domain)
 [30-77]  PS50075
PS50075   ACP_DOMAIN
 [29-76]  2.8e-05 PF00550
PF00550   PP-binding
 [29-80]  3.60000000000001e-10 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [2-83]  7.00000734129903e-10 SSF47336
SSF47336   ACP_like
SignalP
 [1-18]  0.271 Signal
Eukaryota   
TMHMM No significant hit