close all open/close all

CDS information : Griseo_00050


close this sectionLocation

Organism
StrainJP95
Entry nameGriseorhodin A
Contig
Start / Stop / Direction4,744 / 5,715 / + [in whole cluster]
4,744 / 5,715 / + [in contig]
Location4744..5715 [in whole cluster]
4744..5715 [in contig]
TypeCDS
Length972 bp (323 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative cyclase/dehydratase
Product (GenBank)putative cyclase GrhE
Gene
Gene (GenBank)grhE
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in griseorhodin A biosynthesis.
Note (GenBank)
Reference
ACC
PmId
[12323376] A gene cluster from a marine Streptomyces encoding the biosynthesis of the aromatic spiroketal polyketide griseorhodin A. (Chem Biol. , 2002)
Related Reference
ACC
Q54811
NITE
Adria_00240
PmId
[9224566] Iterative type II polyketide synthases, cyclases and ketoreductases exhibit context-dependent behavior in the biosynthesis of linear and angular decapolyketides. (Chem Biol. , 1997)

close this sectionSequence

selected fasta
>putative cyclase/dehydratase [putative cyclase GrhE]
MPETAFHHTSHRVDIAAPAGVVYGLVADAVRWPLFLTPTVHVEALDLEGADQRLRIWALA
CDDVTSWVTRRTLDPAARRIDFRQEVPGPSEPGVTGSWVVEELPEGSSRLTLRSALPASA
TRTTPASWLERAEHDDLLALLADLKHLAERWATLDEHIVAVEETLRVDGPAELAYDFLYR
IENWPAQLPRLTRLDLVEETPGIQQVRMDLLADDGRTHTARGVRVCFPHGGRIVYKLVEP
PASTVAQAGEWSVEPDASGVTLRGRHQAVLRCPDAPSDTEPRTESGGGAGPEVGRMLGRD
SAVVLGLARRYAQSAVRVITPKP
selected fasta
>putative cyclase/dehydratase [putative cyclase GrhE]
ATGCCCGAGACGGCCTTCCACCACACGTCCCACCGTGTGGACATCGCCGCGCCCGCCGGG
GTCGTCTACGGACTGGTCGCGGACGCGGTGCGCTGGCCGCTGTTCCTCACGCCGACCGTG
CATGTGGAGGCGCTGGACCTGGAGGGCGCCGACCAGCGCCTGCGGATCTGGGCGCTGGCC
TGCGACGACGTCACCTCGTGGGTGACCCGGCGCACACTCGACCCGGCCGCGCGGCGGATC
GACTTCCGCCAGGAGGTCCCCGGACCATCCGAGCCGGGGGTGACCGGCTCCTGGGTGGTC
GAGGAACTTCCCGAAGGCTCCTCGCGCCTCACCCTGCGCTCCGCGCTGCCGGCGTCCGCG
ACGCGCACCACCCCCGCGAGCTGGCTCGAACGGGCCGAACACGACGATCTACTGGCCCTG
TTGGCGGATCTGAAGCACCTTGCGGAACGCTGGGCCACGCTGGACGAGCACATCGTGGCC
GTCGAGGAGACCCTGCGTGTCGACGGGCCGGCCGAACTCGCCTACGACTTCCTGTACCGG
ATCGAGAACTGGCCCGCGCAGCTCCCCCGGCTGACCCGCCTCGACCTCGTGGAGGAGACC
CCCGGAATCCAGCAGGTCCGGATGGACCTGCTGGCGGACGACGGCCGTACGCACACCGCC
AGGGGCGTGCGCGTGTGCTTCCCCCACGGCGGCCGGATCGTCTACAAGCTCGTCGAACCG
CCCGCGTCGACCGTCGCCCAGGCCGGGGAGTGGTCGGTCGAGCCCGACGCGAGCGGTGTG
ACCCTCCGCGGCCGCCACCAGGCCGTACTGCGCTGCCCGGACGCGCCGTCGGACACGGAA
CCGCGTACGGAGTCGGGCGGGGGCGCGGGCCCGGAGGTGGGACGGATGCTCGGCCGGGAC
AGCGCCGTCGTGCTGGGTCTTGCCCGGCGGTACGCGCAGAGCGCCGTGCGCGTGATCACG
CCGAAGCCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR019587 Polyketide cyclase/dehydrase (Family)
 [8-143]  7.1e-08 PF10604 [160-264]  3.1e-06 PF10604
PF10604   Polyketide_cyc2
IPR023393 START-like domain (Domain)
 [8-112]  1.1e-07 G3DSA:3.30.530.20
G3DSA:3.30.530.20   G3DSA:3.30.530.20
SignalP No significant hit
TMHMM No significant hit