close all open/close all

CDS information : Griseo_00060


close this sectionLocation

Organism
StrainJP95
Entry nameGriseorhodin A
Contig
Start / Stop / Direction5,777 / 6,580 / + [in whole cluster]
5,777 / 6,580 / + [in contig]
Location5777..6580 [in whole cluster]
5777..6580 [in contig]
TypeCDS
Length804 bp (267 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Productputative phosphopantetheinyl transferase
Product (GenBank)putative phosphopantetheinyl transferase GrhF
Gene
Gene (GenBank)grhF
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[12323376] A gene cluster from a marine Streptomyces encoding the biosynthesis of the aromatic spiroketal polyketide griseorhodin A. (Chem Biol. , 2002)
Family/Domain
FD
IPR008278

close this sectionSequence

selected fasta
>putative phosphopantetheinyl transferase [putative phosphopantetheinyl transferase GrhF]
MPRLAPPVHVGGPDGPWNQLHRQWEDSGGVVVLATWGEWLPAVVTDPRLRGLLGDDWPRY
RRTADATVRHRFAAARFVLKHAAAAALETDPAELDLAYRPGGRPYLRGVRGVDVSLAHTG
ELVVVGLSRTGRIGVDAEPLTRSLSVDVLLARACTPDERAAVKTLGGIGGAAGVTAALLR
LWTLKEAYTKALGCGLRLPFARFGVPWAVEGEAAAYGDEGLLSPGGGPAGPRAWTFGAHR
ALGRYLVGVARHDGAPAAPLRPSSDRP
selected fasta
>putative phosphopantetheinyl transferase [putative phosphopantetheinyl transferase GrhF]
ATGCCGCGCCTCGCGCCGCCCGTGCACGTGGGCGGCCCCGACGGGCCCTGGAACCAGCTC
CACCGGCAGTGGGAGGATTCCGGCGGCGTCGTCGTCCTGGCCACCTGGGGGGAGTGGCTG
CCCGCCGTCGTCACCGACCCCCGGCTGCGCGGCCTGCTCGGCGACGACTGGCCGCGCTAC
CGGCGTACCGCGGACGCCACCGTGCGGCACCGGTTCGCCGCCGCGCGGTTCGTCCTGAAG
CACGCCGCGGCGGCGGCCCTGGAGACCGACCCGGCGGAGCTGGACCTCGCCTACCGGCCC
GGCGGACGCCCGTATCTGCGCGGCGTACGCGGTGTGGACGTGAGCCTCGCCCACACCGGT
GAACTCGTCGTGGTGGGCCTCAGCCGCACCGGGCGGATCGGGGTGGACGCCGAACCCCTC
ACCCGCTCCCTGTCGGTGGACGTCCTGCTCGCCCGCGCCTGCACACCGGACGAGCGGGCC
GCCGTCAAAACCCTCGGGGGCATCGGCGGGGCGGCCGGTGTGACGGCCGCGCTGCTCCGC
CTCTGGACGCTCAAGGAGGCGTACACCAAGGCGCTGGGGTGCGGGCTCCGGCTGCCCTTC
GCCCGGTTCGGCGTGCCCTGGGCCGTCGAGGGGGAGGCCGCCGCGTACGGCGACGAGGGC
CTGCTCTCCCCCGGCGGCGGGCCGGCGGGCCCGCGTGCGTGGACCTTCGGCGCCCACCGG
GCGCTGGGCCGGTACCTCGTCGGCGTGGCCCGCCACGACGGCGCTCCCGCGGCCCCGCTC
CGGCCTTCTTCCGACCGCCCTTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR008278 4'-phosphopantetheinyl transferase (Domain)
 [29-137]  2.800005042611e-17 SSF56214 [131-261]  1e-17 SSF56214
SSF56214   4-PPT_transf
 [132-205]  8.3e-13 PF01648
PF01648   ACPS
 [132-201]  5.5e-12 G3DSA:3.90.470.20
G3DSA:3.90.470.20   G3DSA:3.90.470.20
SignalP No significant hit
TMHMM No significant hit