close all open/close all

CDS information : Griseo_00080


close this sectionLocation

Organism
StrainJP95
Entry nameGriseorhodin A
Contig
Start / Stop / Direction8,502 / 8,843 / + [in whole cluster]
8,502 / 8,843 / + [in contig]
Location8502..8843 [in whole cluster]
8502..8843 [in contig]
TypeCDS
Length342 bp (113 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)GrhH
Gene
Gene (GenBank)grhH
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in griseorhodin A biosynthesis.
Note (GenBank)
Reference
ACC
PmId
[12323376] A gene cluster from a marine Streptomyces encoding the biosynthesis of the aromatic spiroketal polyketide griseorhodin A. (Chem Biol. , 2002)
[19175308] Cleavage of four carbon-carbon bonds during biosynthesis of the griseorhodin a spiroketal pharmacophore. (J Am Chem Soc. , 2009)

close this sectionSequence

selected fasta
>hypothetical protein [GrhH]
MTPTTTGAHTESAPNGTSGPHTEFGRNGTTEPAAGPGPAAVPGTAISARPAWRISGGSPT
AEETAALAAVLAVVLGRAAGGGRDAADAPGSTGTGWHRPPRVRAPSPGTWRGR
selected fasta
>hypothetical protein [GrhH]
ATGACACCGACGACGACCGGCGCGCACACGGAGTCCGCGCCGAACGGGACGAGCGGGCCG
CACACGGAGTTCGGCCGGAACGGGACGACGGAGCCGGCGGCCGGCCCCGGCCCCGCGGCC
GTCCCGGGCACCGCGATCAGCGCCCGCCCTGCCTGGCGGATCTCCGGGGGGTCGCCCACC
GCCGAGGAGACGGCCGCCCTCGCCGCCGTCCTGGCGGTCGTCCTCGGCCGCGCCGCGGGC
GGCGGGCGGGACGCGGCGGACGCGCCGGGGAGCACCGGCACCGGCTGGCACCGGCCGCCC
CGCGTCCGCGCGCCCTCCCCCGGTACGTGGCGCGGCAGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP No significant hit
TMHMM No significant hit