close all open/close all

CDS information : Griseo_00090


close this sectionLocation

Organism
StrainJP95
Entry nameGriseorhodin A
Contig
Start / Stop / Direction9,055 / 9,423 / + [in whole cluster]
9,055 / 9,423 / + [in contig]
Location9055..9423 [in whole cluster]
9055..9423 [in contig]
TypeCDS
Length369 bp (122 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)GrhI
Gene
Gene (GenBank)grhI
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in griseorhodin A biosynthesis.
Note (GenBank)
Reference
ACC
PmId
[12323376] A gene cluster from a marine Streptomyces encoding the biosynthesis of the aromatic spiroketal polyketide griseorhodin A. (Chem Biol. , 2002)
[19175308] Cleavage of four carbon-carbon bonds during biosynthesis of the griseorhodin a spiroketal pharmacophore. (J Am Chem Soc. , 2009)

close this sectionSequence

selected fasta
>hypothetical protein [GrhI]
MSDARLVGTWTTELEDDGKSVFGLASFTGDGGVTCYQVNAKNIGLGNWESTGKDSFHYNF
HILAVNPQGEHVGEAHVFVTGEFVSDDRWEGTGGANFYSPAGDLLRGHEGSRVTARKFGI
DK
selected fasta
>hypothetical protein [GrhI]
ATGAGCGACGCCCGGCTTGTCGGAACCTGGACCACCGAGCTGGAGGACGACGGCAAGTCC
GTGTTCGGACTCGCGTCCTTCACGGGTGACGGCGGCGTCACCTGCTACCAGGTCAACGCC
AAGAACATCGGCCTGGGCAACTGGGAGTCCACCGGGAAGGACTCCTTCCACTACAACTTC
CACATCCTCGCCGTGAACCCGCAGGGCGAGCACGTCGGCGAGGCGCACGTCTTCGTCACC
GGCGAGTTCGTCTCCGACGACCGGTGGGAGGGCACCGGCGGCGCCAACTTCTACTCCCCC
GCCGGCGACCTCCTGCGCGGCCACGAGGGCTCCCGGGTCACCGCCCGCAAGTTCGGCATC
GACAAGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP No significant hit
TMHMM No significant hit