close all open/close all

CDS information : Griseo_00100


close this sectionLocation

Organism
StrainJP95
Entry nameGriseorhodin A
Contig
Start / Stop / Direction9,482 / 10,885 / + [in whole cluster]
9,482 / 10,885 / + [in contig]
Location9482..10885 [in whole cluster]
9482..10885 [in contig]
TypeCDS
Length1,404 bp (467 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative oxidoreductase
Product (GenBank)putative FAD-binding oxidoreductase GrhO1
Gene
Gene (GenBank)grhO1
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[12323376] A gene cluster from a marine Streptomyces encoding the biosynthesis of the aromatic spiroketal polyketide griseorhodin A. (Chem Biol. , 2002)
[19175308] Cleavage of four carbon-carbon bonds during biosynthesis of the griseorhodin a spiroketal pharmacophore. (J Am Chem Soc. , 2009)
Related Reference
ACC
Q9KHK2
NITE
Enter_00130
PmId
[11893195] Mutational analysis of the enterocin favorskii biosynthetic rearrangement. (Org Lett. , 2002)
[15505225] EncM, a versatile enterocin biosynthetic enzyme involved in Favorskii oxidative rearrangement, aldol condensation, and heterocycle-forming reactions. (Proc Natl Acad Sci U S A. , 2004)
[17704772] Enzymatic total synthesis of enterocin polyketides. (Nat Chem Biol. , 2007)

close this sectionSequence

selected fasta
>putative oxidoreductase [putative FAD-binding oxidoreductase GrhO1]
MLRDDLTGELVLPSDPGYRLAKQVQNTEYDAISPRAIAYCTSPDDVLACVRHAREAGIPA
HVRGAGHSFNGWSTGTGLVIDLSRMNHAAADGPTVSIGAGIQSLDALDALKRHDRQIITG
TFPTVGQGGFLSGGGLGWQTRKFGVASDRIVSARVVLADGRAVVASADEHPDLFWALRGG
GGGNFGIVTAFELRPVDAPHLTAFETLWSFDDAADVLTAWQSWAAGESDDLGTSLVVLPG
MFGPGGRPVVKVWGVHHGAAEELERALDALTDLAGVKPAHRETTATGPYADVMHEALCGS
KTVQQCHRTGTGPEAVGHRHPYTRQAYRLTGRPVTRAEAESLLRAWEPDLDAEHYLLCIA
LGGAANRVGRTETAYVHRDARFLTGYQIATRDPEAVARGPVELDAWADRCAEALAPLATG
SYINFPDSRTPPDWEADHYGENAARLRAVKRAYDPDGFFRHGRSIGS
selected fasta
>putative oxidoreductase [putative FAD-binding oxidoreductase GrhO1]
ATGCTGCGCGACGACCTCACAGGCGAGCTCGTTCTCCCCTCCGATCCGGGGTACCGGCTG
GCCAAGCAGGTGCAGAACACCGAGTACGACGCGATCTCGCCCCGCGCCATCGCCTACTGC
ACGTCCCCCGACGACGTCCTGGCCTGCGTGCGCCACGCCCGGGAGGCGGGCATACCGGCG
CACGTCCGGGGGGCCGGCCACAGCTTCAACGGCTGGTCCACCGGGACCGGTCTGGTCATC
GACCTGTCGCGGATGAACCACGCCGCCGCCGACGGCCCCACGGTCAGCATCGGAGCCGGC
ATCCAGTCGCTCGACGCGCTCGACGCGCTCAAGCGGCACGACCGCCAGATCATCACCGGC
ACGTTTCCCACGGTCGGCCAGGGCGGGTTCCTCAGCGGCGGCGGACTGGGCTGGCAGACC
CGGAAGTTCGGGGTGGCGAGCGACCGGATCGTCTCGGCCCGGGTCGTCCTCGCCGACGGC
CGCGCGGTGGTCGCGTCCGCCGACGAGCACCCGGACCTGTTCTGGGCCCTGCGGGGCGGC
GGCGGGGGCAACTTCGGCATCGTCACCGCGTTCGAACTCCGTCCCGTCGACGCCCCGCAC
CTGACCGCCTTCGAGACCCTGTGGTCCTTCGACGACGCCGCGGACGTGCTCACCGCCTGG
CAGTCCTGGGCCGCCGGGGAGTCGGACGACCTCGGCACCTCCCTGGTGGTGCTGCCGGGC
ATGTTCGGCCCCGGCGGCCGGCCGGTCGTCAAGGTCTGGGGGGTGCACCACGGCGCGGCC
GAGGAGCTCGAACGCGCCCTGGACGCGCTCACCGACCTCGCCGGCGTCAAGCCCGCGCAC
CGCGAGACCACGGCGACGGGGCCCTACGCCGACGTCATGCACGAGGCGCTGTGCGGCTCC
AAGACCGTCCAGCAGTGCCACCGCACCGGTACCGGCCCCGAGGCGGTCGGCCACCGGCAC
CCCTACACCCGGCAGGCGTACCGGCTCACCGGCAGGCCCGTCACCCGCGCCGAGGCCGAG
TCCCTGCTGCGGGCGTGGGAGCCCGACCTGGACGCCGAGCACTACCTGCTGTGCATCGCG
CTCGGCGGCGCCGCCAACCGGGTCGGCCGCACCGAGACCGCGTACGTGCACCGCGACGCG
CGGTTCCTGACCGGATACCAGATCGCCACCCGCGACCCGGAGGCCGTCGCGCGCGGCCCG
GTGGAGCTCGACGCGTGGGCCGACCGGTGCGCCGAGGCGCTCGCACCGCTGGCCACGGGC
TCGTACATCAACTTCCCCGATTCACGTACGCCGCCCGACTGGGAGGCCGACCACTACGGC
GAGAACGCCGCCCGGCTGCGCGCGGTGAAGCGCGCCTACGACCCCGACGGCTTCTTCCGG
CACGGCCGGAGCATCGGCTCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006094 FAD linked oxidase, N-terminal (Domain)
 [34-165]  1e-29 PF01565
PF01565   FAD_binding_4
IPR012951 Berberine/berberine-like (Domain)
 [421-465]  6.2e-15 PF08031
PF08031   BBE
IPR016166 FAD-binding, type 2 (Domain)
 [4-198]  2.80000504261099e-48 SSF56176
SSF56176   FAD-binding_2
 [29-198]  PS51387
PS51387   FAD_PCMH
IPR016167 FAD-binding, type 2, subdomain 1 (Domain)
 [24-87]  4.5e-11 G3DSA:3.30.43.10
G3DSA:3.30.43.10   FAD-binding_2_sub1
IPR016168 FAD-linked oxidase, FAD-binding, subdomain 2 (Domain)
 [91-196]  4.2e-11 G3DSA:3.30.465.20
G3DSA:3.30.465.20   FAD-linked_oxidase_FAD-bd_sub2
SignalP
 [1-21]  0.04 Signal
Eukaryota   
 [1-31]  0.047 Signal
Bacteria, Gram-positive   
TMHMM No significant hit