close all open/close all

CDS information : Griseo_00110


close this sectionLocation

Organism
StrainJP95
Entry nameGriseorhodin A
Contig
Start / Stop / Direction10,944 / 11,717 / + [in whole cluster]
10,944 / 11,717 / + [in contig]
Location10944..11717 [in whole cluster]
10944..11717 [in contig]
TypeCDS
Length774 bp (257 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative oxidoreductase
Product (GenBank)putative 3-oxoacyl-ACP reductase GrhO2
Gene
Gene (GenBank)grhO2
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in griseorhodin A biosynthesis.
Note (GenBank)
Reference
ACC
PmId
[12323376] A gene cluster from a marine Streptomyces encoding the biosynthesis of the aromatic spiroketal polyketide griseorhodin A. (Chem Biol. , 2002)
[19175308] Cleavage of four carbon-carbon bonds during biosynthesis of the griseorhodin a spiroketal pharmacophore. (J Am Chem Soc. , 2009)
Related Reference
ACC
P50205
PmId
[7582015] Poly-beta-hydroxybutyrate (PHB) biosynthetic genes in Rhizobium meliloti 41. (Microbiology. , 1995)

close this sectionSequence

selected fasta
>putative oxidoreductase [putative 3-oxoacyl-ACP reductase GrhO2]
MKTGLTDKAVLVTGASRGIGRATALAYAAEGARVAITYHSDEAGAKETAERVAAAGGTPH
VVRYDLGDEDSVRSAVASVGAEWGGVDVLVAGAVEWGEAIPRPGRKMPAFEEVPPAQWQR
VLRTSVDGVFHTVQAVLPLMRDREWGRIVVLGAGLAETGLPGASAYGAAKAALHGLVRSL
AWEVGPAGILVNEVVPGQTLTENVLAHASPAFLENKAASLPSGRMNTPEDVARAIVFLGS
AANGNIHGEALRVTGGL
selected fasta
>putative oxidoreductase [putative 3-oxoacyl-ACP reductase GrhO2]
ATGAAGACAGGACTGACGGACAAGGCGGTGCTCGTCACCGGCGCCTCGCGCGGCATCGGG
CGGGCCACGGCCCTCGCCTACGCGGCGGAGGGCGCCCGGGTCGCGATCACCTACCACTCC
GACGAGGCCGGGGCGAAGGAGACGGCCGAGCGGGTCGCCGCCGCCGGGGGCACCCCCCAC
GTCGTCCGCTACGACCTCGGGGACGAGGACTCCGTGCGCTCCGCCGTCGCCTCGGTCGGC
GCGGAGTGGGGCGGGGTCGACGTCCTCGTGGCCGGCGCGGTCGAGTGGGGGGAGGCGATT
CCGCGCCCCGGACGGAAGATGCCCGCCTTCGAGGAGGTGCCGCCCGCGCAGTGGCAACGG
GTCCTGCGCACCTCGGTGGACGGCGTCTTCCACACCGTGCAGGCGGTGCTGCCCCTCATG
CGCGACCGGGAGTGGGGCCGCATCGTGGTGCTCGGCGCCGGGCTCGCGGAGACCGGTCTG
CCGGGGGCGTCCGCGTACGGGGCCGCGAAGGCCGCCCTGCACGGGCTGGTGCGCAGCCTG
GCCTGGGAGGTCGGCCCCGCCGGGATCCTGGTCAACGAGGTCGTGCCCGGCCAGACGCTC
ACCGAGAACGTCCTCGCACACGCCTCGCCCGCCTTCCTGGAGAACAAGGCCGCCTCCCTG
CCCTCGGGCCGCATGAACACGCCCGAGGACGTCGCGCGGGCGATCGTCTTCCTCGGCTCC
GCCGCCAACGGGAACATCCACGGCGAGGCCCTGCGCGTCACCGGCGGCCTGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [8-182]  9.7e-31 PF00106
PF00106   adh_short
IPR002347 Glucose/ribitol dehydrogenase (Family)
 [9-26]  2.800005042611e-30 PR00081 [84-95]  2.800005042611e-30 PR00081 [140-156]  2.800005042611e-30 PR00081 [166-185]  2.800005042611e-30 PR00081 [187-204]  2.800005042611e-30 PR00081 [221-241]  2.800005042611e-30 PR00081
PR00081   GDHRDH
IPR016040 NAD(P)-binding domain (Domain)
 [5-257]  1.29999999999998e-72 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR020904 Short-chain dehydrogenase/reductase, conserved site (Conserved_site)
 [153-181]  PS00061
PS00061   ADH_SHORT
SignalP
 [1-28]  0.671 Signal
Bacteria, Gram-negative   
 [1-28]  0.598 Signal
Bacteria, Gram-positive   
TMHMM No significant hit