close all open/close all

CDS information : Griseo_00120


close this sectionLocation

Organism
StrainJP95
Entry nameGriseorhodin A
Contig
Start / Stop / Direction11,774 / 13,024 / + [in whole cluster]
11,774 / 13,024 / + [in contig]
Location11774..13024 [in whole cluster]
11774..13024 [in contig]
TypeCDS
Length1,251 bp (416 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative cytochrome P450
Product (GenBank)putative cytochrome P450 GrhO3
Gene
Gene (GenBank)grhO3
EC number
Keyword
  • epoxidation
Note
Note (GenBank)
Reference
ACC
PmId
[12323376] A gene cluster from a marine Streptomyces encoding the biosynthesis of the aromatic spiroketal polyketide griseorhodin A. (Chem Biol. , 2002)
[19175308] Cleavage of four carbon-carbon bonds during biosynthesis of the griseorhodin a spiroketal pharmacophore. (J Am Chem Soc. , 2009)
Related Reference
ACC
B3XWK3
PmId
[18640605] Increase in pladienolide D production rate using a Streptomyces strain overexpressing a cytochrome P450 gene. (J Biosci Bioeng. , 2008)
ACC
Q9EW92
NITE
Pimar_00180
PmId
[15228385] Characterization of the polyene macrolide P450 epoxidase from Streptomyces natalensis that converts de-epoxypimaricin into pimaricin. (Biochem J. , 2005)

close this sectionSequence

selected fasta
>putative cytochrome P450 [putative cytochrome P450 GrhO3]
MTDTLDEPQTLADGAEDAPAYPVKRTCPYRMPPGYEELREKGPISRVTLWNGRTAWLVTG
NDLGRRLFPDARLSSDVLDPRFPLLAPRIEAQRQQAAAPPLVGVDDPVHARQRRMVLPSF
GIRQINALRPEIQKYADDLLDTMLAKGPGVTVDLLTEYALPMPSAVICMLLGVPYEDHHY
FDERSRHVLSSSGEEQAAQAQQAFTEILAYLDDLIVRKQAEPGDTLLDELIARQLEEGKV
DRQELAMIATVLLVSGHETTSNMIALSTMALLADPDQLAALRADESLMPRAVDELMRFSS
IGDMLMRVAKEDIEIEGHLIRAGDGVILSTMLMNRDPGAFERPDELDIRRPAGRHVAFGY
GIHQCIGQNLARAEMEIALATLFRRVPTLKLAVPAEQVPVNAPFVLQGVSELPVTW
selected fasta
>putative cytochrome P450 [putative cytochrome P450 GrhO3]
ATGACCGACACACTCGACGAGCCGCAGACGCTGGCGGACGGCGCCGAGGACGCGCCCGCC
TACCCCGTCAAACGCACCTGCCCCTACCGGATGCCGCCCGGCTACGAGGAACTCCGGGAG
AAGGGCCCCATCTCCCGGGTGACCCTCTGGAACGGACGGACGGCCTGGCTGGTCACCGGC
AACGACCTCGGCCGCAGGCTGTTCCCGGACGCCCGGCTCTCCTCGGACGTCCTGGACCCG
CGCTTCCCGCTGCTCGCGCCCCGGATCGAGGCGCAGCGGCAGCAGGCCGCCGCGCCGCCG
CTGGTCGGCGTCGACGACCCGGTCCACGCCCGTCAGCGCCGCATGGTGCTGCCGAGCTTC
GGCATCCGCCAGATCAACGCGCTGCGCCCGGAGATCCAGAAGTACGCCGACGACCTGCTG
GACACGATGCTGGCCAAGGGTCCGGGCGTCACCGTCGACCTGCTCACCGAGTACGCGCTA
CCGATGCCGTCCGCCGTGATCTGCATGCTGCTCGGCGTCCCGTACGAGGACCACCACTAC
TTCGACGAGCGCTCGCGCCACGTCCTGTCCTCGTCCGGCGAGGAGCAGGCGGCGCAGGCG
CAGCAGGCGTTCACCGAGATCCTGGCCTACCTGGACGACCTGATCGTCCGCAAGCAGGCC
GAGCCCGGCGACACCCTCCTCGACGAGCTCATCGCCCGCCAGTTGGAGGAGGGCAAGGTC
GACCGCCAGGAGCTGGCGATGATCGCCACCGTGCTGCTGGTCTCCGGGCACGAGACGACC
TCGAACATGATCGCCCTCTCCACGATGGCGCTGCTGGCCGACCCGGACCAGTTGGCGGCC
CTGCGCGCCGACGAGTCCCTGATGCCCCGCGCCGTCGACGAGCTGATGCGGTTCTCCTCC
ATCGGCGACATGCTGATGCGCGTGGCCAAGGAGGACATCGAGATCGAGGGCCACCTCATC
CGGGCCGGCGACGGGGTGATCCTCTCGACCATGCTGATGAACCGCGACCCCGGGGCCTTC
GAGCGCCCCGACGAGCTGGACATCCGCCGGCCCGCGGGCCGCCACGTCGCGTTCGGCTAC
GGCATCCACCAGTGCATCGGGCAGAACCTGGCCCGCGCCGAGATGGAGATCGCGCTGGCC
ACCCTGTTCCGCCGGGTGCCGACGCTGAAGCTCGCGGTCCCCGCCGAGCAGGTGCCCGTC
AACGCGCCGTTCGTCCTCCAGGGAGTCTCCGAACTCCCCGTCACCTGGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [255-272]  5.20000089003336e-07 PR00385 [290-301]  5.20000089003336e-07 PR00385 [356-365]  5.20000089003336e-07 PR00385 [365-376]  5.20000089003336e-07 PR00385
PR00385   P450
 [107-385]  1.1e-27 PF00067
PF00067   p450
 [28-416]  1.3000049540733e-93 SSF48264
SSF48264   Cytochrome_P450
 [27-416]  2.99999999999998e-103 G3DSA:1.10.630.10
G3DSA:1.10.630.10   Cyt_P450
IPR002397 Cytochrome P450, B-class (Family)
 [104-115]  3.59998852907783e-53 PR00359 [153-169]  3.59998852907783e-53 PR00359 [170-185]  3.59998852907783e-53 PR00359 [209-231]  3.59998852907783e-53 PR00359 [290-301]  3.59998852907783e-53 PR00359 [307-334]  3.59998852907783e-53 PR00359 [335-350]  3.59998852907783e-53 PR00359 [356-365]  3.59998852907783e-53 PR00359 [365-376]  3.59998852907783e-53 PR00359
PR00359   BP450
IPR017972 Cytochrome P450, conserved site (Conserved_site)
 [358-367]  PS00086
PS00086   CYTOCHROME_P450
SignalP No significant hit
TMHMM No significant hit