close all open/close all

CDS information : Griseo_00130


close this sectionLocation

Organism
StrainJP95
Entry nameGriseorhodin A
Contig
Start / Stop / Direction13,031 / 13,234 / + [in whole cluster]
13,031 / 13,234 / + [in contig]
Location13031..13234 [in whole cluster]
13031..13234 [in contig]
TypeCDS
Length204 bp (67 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.5 electron carrier
Productputative ferredoxin
Product (GenBank)putative ferredoxin GrhO4
Gene
Gene (GenBank)grhO4
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[12323376] A gene cluster from a marine Streptomyces encoding the biosynthesis of the aromatic spiroketal polyketide griseorhodin A. (Chem Biol. , 2002)
Related Reference
ACC
B3XWK4
PmId
[18640605] Increase in pladienolide D production rate using a Streptomyces strain overexpressing a cytochrome P450 gene. (J Biosci Bioeng. , 2008)

close this sectionSequence

selected fasta
>putative ferredoxin [putative ferredoxin GrhO4]
MHLSVDSDRCIGSAQCAVTVPSVFEQDEDGLSTVIPGREDGGGEPMVREAVRACPVQAIV
LKETEGV
selected fasta
>putative ferredoxin [putative ferredoxin GrhO4]
GTGCACCTCTCCGTCGACTCCGACCGCTGCATCGGCTCCGCCCAGTGCGCCGTCACCGTG
CCCTCCGTCTTCGAGCAGGACGAGGACGGGCTCTCCACCGTCATCCCCGGCCGCGAGGAC
GGCGGTGGCGAGCCGATGGTGCGCGAGGCCGTCCGGGCCTGCCCGGTGCAGGCCATCGTG
CTGAAGGAGACCGAGGGCGTATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001080 3Fe-4S ferredoxin (Family)
 [5-16]  2.00000075217457e-07 PR00352 [16-26]  2.00000075217457e-07 PR00352 [47-59]  2.00000075217457e-07 PR00352
PR00352   3FE4SFRDOXIN
IPR017896 4Fe-4S ferredoxin-type, iron-sulpur binding domain (Domain)
 [1-29]  PS51379
PS51379   4FE4S_FER_2
SignalP No significant hit
TMHMM No significant hit