close all open/close all

CDS information : Griseo_00140


close this sectionLocation

Organism
StrainJP95
Entry nameGriseorhodin A
Contig
Start / Stop / Direction13,473 / 14,360 / + [in whole cluster]
13,473 / 14,360 / + [in contig]
Location13473..14360 [in whole cluster]
13473..14360 [in contig]
TypeCDS
Length888 bp (295 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative acetyltransferase
Product (GenBank)GrhJ
Gene
Gene (GenBank)grhJ
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[12323376] A gene cluster from a marine Streptomyces encoding the biosynthesis of the aromatic spiroketal polyketide griseorhodin A. (Chem Biol. , 2002)
[19175308] Cleavage of four carbon-carbon bonds during biosynthesis of the griseorhodin a spiroketal pharmacophore. (J Am Chem Soc. , 2009)
Family/Domain
FD
IPR000182

close this sectionSequence

selected fasta
>putative acetyltransferase [GrhJ]
MSLELPGDPPVSPALLARLLQRRHGADRIVLAAFDGDRPAGCTKLGLDLGVPDGPGHGSL
WVFPGFRRRGAGTALVSAARTELRARGRDLLMVDAPHTPAAERFAAACGAEALGTNLRNR
LLLKGPGRAGLDAAAGRAVPGHRLVHWSGRCPDELVDSYARAWGALETAANGQAAVRRPA
AADVRAREAEAERAGHRPYVTAAVDTAGEVVGYATLFVRDSPMADAGETLVVAGRRRRGL
GSWTKAALLSRAAAENPHLALVQAWNDVRDEASLALNRRLGFVGDSSWTTNAVKA
selected fasta
>putative acetyltransferase [GrhJ]
ATGAGCCTCGAACTGCCCGGCGATCCGCCGGTGTCACCCGCGCTGCTGGCCCGGCTGCTG
CAACGCCGGCACGGCGCCGACCGGATCGTCCTCGCGGCGTTCGACGGCGACCGGCCGGCC
GGCTGCACCAAGCTCGGCCTCGACCTCGGCGTCCCGGACGGGCCCGGCCACGGCTCGCTC
TGGGTCTTCCCCGGGTTCCGCCGCCGGGGCGCGGGCACCGCCCTCGTCTCCGCCGCCCGG
ACCGAACTGCGCGCCCGCGGGCGGGACCTGCTGATGGTCGACGCCCCGCACACCCCGGCC
GCCGAGCGCTTCGCCGCCGCCTGCGGGGCCGAGGCGCTGGGCACCAACCTGCGCAACCGG
CTCCTCCTCAAGGGGCCCGGCCGCGCCGGGCTCGACGCGGCGGCCGGCCGCGCGGTGCCG
GGGCACCGGCTCGTCCACTGGAGCGGCCGCTGCCCCGACGAGCTGGTCGACTCCTACGCC
CGTGCCTGGGGCGCCCTGGAGACGGCGGCCAACGGCCAGGCGGCGGTGCGCCGTCCCGCC
GCCGCCGACGTACGCGCCCGTGAGGCCGAGGCGGAGCGCGCCGGGCACCGCCCGTACGTG
ACGGCGGCCGTGGACACGGCCGGCGAAGTCGTGGGCTACGCCACGCTGTTCGTCCGGGAC
AGCCCGATGGCCGACGCCGGGGAGACCCTGGTCGTCGCCGGCCGGCGGCGCCGGGGGCTG
GGCTCCTGGACCAAGGCCGCCCTGCTCTCCCGGGCCGCCGCCGAGAACCCCCACCTCGCG
CTGGTGCAGGCGTGGAACGACGTACGCGACGAGGCGTCCCTCGCCCTCAATCGCCGCCTC
GGCTTCGTGGGGGACAGCTCCTGGACCACGAACGCCGTCAAGGCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000182 GNAT domain (Domain)
 [1-128]  PS51186 [154-295]  PS51186
PS51186   GNAT
 [35-110]  4.1e-06 PF00583
PF00583   Acetyltransf_1
IPR016181 Acyl-CoA N-acyltransferase (Domain)
 [12-104]  1.7e-16 G3DSA:3.40.630.30 [183-287]  2.3e-20 G3DSA:3.40.630.30
G3DSA:3.40.630.30   Acyl_CoA_acyltransferase
 [5-115]  3.00000067992871e-15 SSF55729 [153-289]  3.1999989904635e-09 SSF55729
SSF55729   Acyl_CoA_acyltransferase
SignalP No significant hit
TMHMM No significant hit