close all open/close all

CDS information : Griseo_00150


close this sectionLocation

Organism
StrainJP95
Entry nameGriseorhodin A
Contig
Start / Stop / Direction14,492 / 16,105 / + [in whole cluster]
14,492 / 16,105 / + [in contig]
Location14492..16105 [in whole cluster]
14492..16105 [in contig]
TypeCDS
Length1,614 bp (537 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative oxidoreductase
Product (GenBank)putative FAD-dependent monooxygenase GrhO5
Gene
Gene (GenBank)grhO5
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[12323376] A gene cluster from a marine Streptomyces encoding the biosynthesis of the aromatic spiroketal polyketide griseorhodin A. (Chem Biol. , 2002)
[17625850] Biosynthesis of pentangular polyphenols: deductions from the benastatin and griseorhodin pathways. (J Am Chem Soc. , 2007)
Related Reference
ACC
Q8KSX1
NITE
Griseo_00210
ACC
Q8KSX0
NITE
Griseo_00220
ACC
Q2PWU9
PmId
[8830701] Purification and sequence analysis of 4-methyl-5-nitrocatechol oxygenase from Burkholderia sp. strain DNT. (J Bacteriol. , 1996)
[16751499] Protein engineering of the 4-methyl-5-nitrocatechol monooxygenase from Burkholderia sp. strain DNT for enhanced degradation of nitroaromatics. (Appl Environ Microbiol. , 2006)
ACC
Q9L4Y1
NITE
Ello_00070
PmId
[11325225] Cloning, sequencing, and heterologous expression of the elmGHIJ genes involved in the biosynthesis of the polyketide antibiotic elloramycin from Streptomyces olivaceus Tu2353. (J Nat Prod. , 2001)
ACC
P39888
PmId
[8509339] Nucleotide sequences and heterologous expression of tcmG and tcmP, biosynthetic genes for tetracenomycin C in Streptomyces glaucescens. (J Bacteriol. , 1993)

close this sectionSequence

selected fasta
>putative oxidoreductase [putative FAD-dependent monooxygenase GrhO5]
MSSSGTRVLIVGGSLVGLSTAVFLAHHDVPVTLVERHPGTSIHPRAVGYYPRTAELLATV
GVEAPAKAAASGFEKHRTRAGVESLAGEVLFSKEELEGGDELADLTPSSLLLLPQDRLEP
ILRARAEELGAELRFGAELRSFTQDADGVSAVVRDADGGESVVRADYLVAADGPRSTVRE
ALGIGREGRGVLSRHVSIAFGADFAAVLGERRYSVVHVQNDRVTGILVHDDTLTEGTLIV
GYDPEKGEGLDDFTDARCAELVSAAIGSDDVAVTIRSRFPWDMAELVADAFVSDRVLVAG
DAAHQIPPTGGYGANTGIADAFNLSWKLAHVLAGTAGRALLDTYDEERRPVGLYTARQGS
LQLAVRSRTATEEQREAAHDAMRVTMGQAYPSGAFVADAGADPLPLTSDPRTLRGEPGTR
APYVVLERDGAPLSTLDLFGDGFVLLVGADGGSWAEAAGEAAAGLGVGIAFHRVAPDAGE
GRPVDVHGRWAEAYGVGAAGAVLVRPDGIVAWRSRDGMPGGAGGRALTAALRTVLAR
selected fasta
>putative oxidoreductase [putative FAD-dependent monooxygenase GrhO5]
GTGAGCAGCAGCGGCACACGCGTACTGATCGTCGGTGGCAGCCTCGTCGGCCTGTCCACC
GCTGTCTTCCTGGCCCACCACGACGTGCCGGTCACCCTGGTGGAGCGGCACCCCGGCACC
TCGATCCACCCGCGCGCGGTCGGCTACTACCCGCGTACCGCCGAGCTGCTGGCCACGGTC
GGCGTCGAGGCCCCGGCCAAGGCCGCCGCCTCCGGGTTCGAGAAGCACCGGACCCGCGCG
GGCGTGGAGTCCCTGGCGGGCGAAGTGCTGTTCTCCAAGGAGGAGTTGGAGGGCGGGGAC
GAGCTGGCCGACCTGACCCCGTCCTCCCTGCTGCTGCTTCCGCAGGACCGCCTGGAGCCG
ATCCTGCGCGCCCGCGCGGAGGAGTTGGGCGCCGAGCTGCGGTTCGGCGCCGAGCTGCGC
TCCTTCACCCAGGACGCGGACGGGGTCAGCGCGGTCGTCCGGGACGCGGACGGCGGCGAG
AGCGTGGTGCGCGCCGACTACCTGGTGGCCGCCGACGGGCCGCGCAGCACCGTGCGCGAG
GCGCTCGGCATCGGCCGGGAAGGACGCGGCGTGCTCTCGCGGCACGTGAGCATCGCGTTC
GGCGCGGACTTCGCCGCGGTGCTGGGAGAGCGCCGCTACAGCGTGGTCCACGTCCAGAAC
GACCGGGTCACCGGCATCCTCGTGCACGACGACACCCTCACCGAGGGCACCCTGATCGTC
GGCTACGACCCGGAGAAGGGCGAGGGACTGGACGACTTCACCGACGCCCGGTGCGCGGAA
CTGGTCTCGGCGGCCATCGGTTCGGACGACGTCGCCGTCACCATCCGCTCCCGCTTCCCG
TGGGACATGGCCGAGCTGGTCGCCGACGCGTTCGTCAGCGACCGCGTCCTGGTCGCGGGC
GACGCCGCCCACCAGATCCCGCCGACCGGGGGGTACGGCGCGAACACCGGGATCGCCGAC
GCCTTCAACCTGAGCTGGAAGCTGGCGCACGTCCTCGCGGGCACCGCCGGCCGCGCGCTG
CTGGACACGTACGACGAGGAGCGGCGGCCGGTCGGGCTGTACACGGCGCGGCAGGGATCG
CTCCAGCTCGCAGTGCGGTCCCGGACCGCGACGGAGGAGCAGCGGGAGGCGGCGCACGAC
GCGATGCGGGTCACCATGGGGCAGGCGTACCCCTCCGGCGCCTTCGTCGCCGACGCGGGG
GCCGATCCGCTGCCGCTGACCTCGGATCCGCGGACGCTGCGCGGCGAGCCGGGCACGCGC
GCCCCGTACGTGGTGCTGGAGCGCGACGGCGCCCCGCTGTCCACGCTGGACCTGTTCGGG
GACGGCTTCGTGCTGCTGGTCGGGGCCGACGGCGGCTCGTGGGCCGAGGCGGCCGGGGAG
GCCGCCGCCGGGCTGGGCGTGGGCATCGCCTTCCACCGCGTCGCGCCGGACGCCGGTGAG
GGACGGCCGGTCGACGTGCACGGCCGCTGGGCCGAGGCGTACGGGGTGGGCGCGGCGGGC
GCGGTGCTGGTGCGGCCCGACGGGATCGTGGCGTGGCGCAGCCGGGACGGCATGCCGGGC
GGGGCAGGGGGCCGCGCGCTCACGGCGGCGCTGCGGACCGTCCTGGCGCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002938 Monooxygenase, FAD-binding (Domain)
 [6-352]  1.20000000000001e-92 PF01494
PF01494   FAD_binding_3
IPR003042 Aromatic-ring hydroxylase-like (Domain)
 [7-29]  1.20000117458134e-37 PR00420 [164-179]  1.20000117458134e-37 PR00420 [293-308]  1.20000117458134e-37 PR00420 [308-324]  1.20000117458134e-37 PR00420 [326-344]  1.20000117458134e-37 PR00420 [344-360]  1.20000117458134e-37 PR00420
PR00420   RNGMNOXGNASE
SignalP
 [1-24]  0.463 Signal
Bacteria, Gram-positive   
 [1-24]  0.726 Signal
Eukaryota   
TMHMM No significant hit