close all open/close all

CDS information : Griseo_00160


close this sectionLocation

Organism
StrainJP95
Entry nameGriseorhodin A
Contig
Start / Stop / Direction16,679 / 16,161 / - [in whole cluster]
16,679 / 16,161 / - [in contig]
Locationcomplement(16161..16679) [in whole cluster]
complement(16161..16679) [in contig]
TypeCDS
Length519 bp (172 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative MarR family transcriptional regulator
Product (GenBank)putative transcriptional repressor GrhR3
Gene
Gene (GenBank)grhR3
EC number
Keyword
Note
Note (GenBank)
  • MarR family
Reference
ACC
PmId
[12323376] A gene cluster from a marine Streptomyces encoding the biosynthesis of the aromatic spiroketal polyketide griseorhodin A. (Chem Biol. , 2002)
Family/Domain
FD
IPR000835

close this sectionSequence

selected fasta
>putative MarR family transcriptional regulator [putative transcriptional repressor GrhR3]
METSPAGRKPAQPLSDNGALAAMDPLDAVGPAFSRLRRASALNAESPVSRKDMTRTLVLN
IVDEGPEHDGQEITVGVVAERLAVDPSVASRMVTDCIAAGYLIRAASQQDGRRTILQMTD
DGQGMLAAFRRHQRAAFEFITREWPEGEREQLARLLIKYVDSVAQARGALDS
selected fasta
>putative MarR family transcriptional regulator [putative transcriptional repressor GrhR3]
ATGGAGACCTCACCCGCCGGGCGGAAGCCCGCGCAGCCGCTGTCCGACAACGGCGCACTG
GCCGCCATGGACCCGCTCGACGCGGTGGGCCCCGCCTTCTCGCGACTGCGCCGCGCCTCC
GCCCTCAACGCGGAGAGCCCGGTGTCCCGGAAGGACATGACGCGGACGCTGGTGCTCAAC
ATCGTGGACGAGGGGCCCGAGCACGACGGGCAGGAGATCACCGTCGGCGTCGTCGCCGAG
CGGCTCGCCGTGGACCCCTCCGTGGCCAGCCGCATGGTCACCGACTGCATCGCCGCGGGC
TACCTGATCCGCGCCGCCTCCCAGCAGGACGGCCGGCGCACGATCCTCCAGATGACGGAC
GACGGGCAGGGCATGCTGGCGGCCTTCCGCCGGCACCAGCGGGCGGCCTTCGAGTTCATC
ACCCGGGAGTGGCCCGAGGGGGAACGCGAGCAGCTCGCCCGCCTGCTGATCAAGTACGTC
GACTCCGTCGCGCAGGCCCGGGGCGCCCTCGACTCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000835 Transcription regulator HTH, MarR-type (Family)
 [26-161]  PS50995
PS50995   HTH_MARR_2
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [25-161]  2.90000000000001e-22 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
SignalP No significant hit
TMHMM No significant hit