close all open/close all

CDS information : Griseo_00180


close this sectionLocation

Organism
StrainJP95
Entry nameGriseorhodin A
Contig
Start / Stop / Direction18,609 / 19,586 / + [in whole cluster]
18,609 / 19,586 / + [in contig]
Location18609..19586 [in whole cluster]
18609..19586 [in contig]
TypeCDS
Length978 bp (325 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative oxidoreductase
Product (GenBank)putative NADPH:quinone oxidoreductase GrhO7
Gene
Gene (GenBank)grhO7
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[12323376] A gene cluster from a marine Streptomyces encoding the biosynthesis of the aromatic spiroketal polyketide griseorhodin A. (Chem Biol. , 2002)
[19175308] Cleavage of four carbon-carbon bonds during biosynthesis of the griseorhodin a spiroketal pharmacophore. (J Am Chem Soc. , 2009)
Related Reference
ACC
Q53927
NITE
Actino_00040
PmId
[7929165] DNA sequence and functions of the actVI region of the actinorhodin biosynthetic gene cluster of Streptomyces coelicolor A3(2). (J Biol Chem. , 1994)
[10805574] Chemical characterisation of disruptants of the Streptomyces coelicolor A3(2) actVI genes involved in actinorhodin biosynthesis. (J Antibiot (Tokyo). , 2000)
ACC
Q59I44
PmId
[15781461] 2-Haloacrylate reductase, a novel enzyme of the medium chain dehydrogenase/reductase superfamily that catalyzes the reduction of a carbon-carbon double bond of unsaturated organohalogen compounds. (J Biol Chem. , 2005)

close this sectionSequence

selected fasta
>putative oxidoreductase [putative NADPH:quinone oxidoreductase GrhO7]
MRIVRHYEHGAPSVLRLEEVEKPQPGPGQVLIRAEAIGVTFAEVQRRQGIPIGGHAGLPG
APGGDVAGTVEALGEGVTGFAVGDRVVGDVDRDAYADYVVTGTDWLIKIPQDLDAAAATL
LPSPAQTAYHAIKEAGRLRPGQSIVIDAASGGVGHLAVQIAKALGAGKVIATASTQAKLD
FARELGADVTVNYTDEDWTDQVLAATDGRGADIVLETVGGDVLLKSLGITAQFGTLVFYG
SASGDIPDLPTLALSRMKNVAGFSLYAMLYNKQDAVAEGQRHLLDLIASGEVKPVVHDRL
PLDEAVKAHELLEARAQLGKIVLVP
selected fasta
>putative oxidoreductase [putative NADPH:quinone oxidoreductase GrhO7]
ATGCGCATCGTCCGCCACTACGAGCACGGCGCGCCGTCCGTGCTGCGCCTCGAAGAGGTG
GAGAAGCCGCAGCCCGGCCCGGGTCAGGTCCTGATCCGTGCCGAGGCCATCGGCGTCACC
TTCGCAGAGGTCCAGCGCCGCCAGGGCATTCCGATCGGCGGCCACGCCGGGCTCCCCGGC
GCCCCCGGCGGCGATGTCGCGGGCACCGTCGAGGCGCTCGGCGAGGGCGTCACCGGCTTC
GCCGTCGGCGACCGCGTCGTCGGCGACGTCGACCGGGACGCCTACGCCGACTACGTCGTC
ACCGGCACGGACTGGCTCATCAAGATCCCGCAGGACCTCGACGCCGCCGCGGCGACCCTG
CTCCCGAGCCCGGCCCAGACCGCGTACCACGCGATCAAGGAGGCCGGCCGCCTCCGGCCC
GGCCAGAGCATCGTGATCGACGCGGCCTCCGGCGGCGTCGGCCACCTGGCCGTCCAGATC
GCCAAGGCCCTCGGCGCCGGCAAGGTCATCGCGACCGCGAGCACGCAGGCCAAGCTCGAC
TTCGCCCGCGAACTCGGCGCCGACGTCACCGTCAACTACACCGACGAGGACTGGACCGAC
CAGGTCCTCGCCGCCACCGACGGGCGCGGGGCCGACATCGTCCTGGAGACCGTCGGCGGC
GACGTCCTGCTCAAGTCGCTCGGCATCACCGCCCAGTTCGGGACGCTCGTCTTCTACGGT
TCGGCCTCCGGCGACATCCCGGACCTGCCCACCCTCGCGCTGTCCCGCATGAAGAACGTC
GCGGGCTTCAGCCTCTACGCCATGCTCTACAACAAGCAGGACGCCGTGGCCGAGGGGCAG
CGCCACCTGCTCGACCTCATCGCCTCCGGCGAGGTCAAGCCCGTCGTGCACGACCGGCTG
CCGCTCGACGAGGCGGTCAAGGCCCACGAGTTGCTGGAGGCACGGGCCCAGCTCGGCAAG
ATCGTCCTCGTTCCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR011032 GroES-like (Domain)
 [1-145]  1.20000117458134e-37 SSF50129
SSF50129   GroES_like
IPR013149 Alcohol dehydrogenase, C-terminal (Domain)
 [152-267]  1.4e-31 PF00107
PF00107   ADH_zinc_N
IPR013154 Alcohol dehydrogenase GroES-like (Domain)
 [27-89]  3.5e-08 PF08240
PF08240   ADH_N
IPR016040 NAD(P)-binding domain (Domain)
 [149-260]  3.40000000000004e-36 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP No significant hit
TMHMM No significant hit