close all open/close all

CDS information : Griseo_00190


close this sectionLocation

Organism
StrainJP95
Entry nameGriseorhodin A
Contig
Start / Stop / Direction19,815 / 21,404 / + [in whole cluster]
19,815 / 21,404 / + [in contig]
Location19815..21404 [in whole cluster]
19815..21404 [in contig]
TypeCDS
Length1,590 bp (529 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative drug resistance transporter
Product (GenBank)putative efflux protein GrhK
Gene
Gene (GenBank)grhK
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[12323376] A gene cluster from a marine Streptomyces encoding the biosynthesis of the aromatic spiroketal polyketide griseorhodin A. (Chem Biol. , 2002)
Related Reference
ACC
Q9ZGB6
NITE
Lando_00240
PmId
[18537830] Coordination of export and glycosylation of landomycins in Streptomyces cyanogenus S136. (FEMS Microbiol Lett. , 2008)

close this sectionSequence

selected fasta
>putative drug resistance transporter [putative efflux protein GrhK]
MSAPTPPAPGGPHPSGTRTTPVMVACMLSAFVAILDLQIVSTALPRIAGDLGGIDLFAWV
TIAYVIASSVTTPIYGKLGDLFGRKVTYLSAMGLFLLGSALAGAAGSMEQLIVFRIVQGL
GAGGLFVSVLAIIGELFTPREGAKYYGMFGMVFAGASLAGPAVGGLLTDALSWHWVFLVN
LPVGAVIVALLVKYLHLPRKAAAGAKLDYAGIVTLSAAIIALTLLTSWGGVEYAWTSPQI
IGLGLGTLVFLGLFVKAESTASEPIVPLRLFRDSTFTISLLGTTVCGIVFVGAVQFLALY
VQVATGASPTASGFILLPMMMGLVLSSVGSSRIIMKTGTYKIFPILSMALGIVGALLLST
MDSDTPRVLTILYMVVFGFASGLSAQVFTQAAQNTAPPQDMGAVSGTVTFGRSFGTSIGI
SLFAAVFYGRLTDELAARVPDGALDGIDRNSLSSDTVLATLADPVRGAVEDAYAASLTPV
FTTAVPILAVGLVLTLLMKNLTLRSRHHGADEPAESPAPAAADGTPETA
selected fasta
>putative drug resistance transporter [putative efflux protein GrhK]
ATGTCCGCTCCCACTCCCCCGGCCCCCGGGGGCCCGCACCCCTCCGGCACCAGGACCACC
CCGGTCATGGTCGCCTGCATGCTCTCCGCGTTCGTGGCCATCCTCGACCTGCAGATCGTC
TCCACCGCCCTGCCCCGCATCGCGGGCGACCTCGGCGGCATCGACCTCTTCGCCTGGGTG
ACCATCGCCTACGTCATCGCCTCCAGCGTCACCACGCCGATCTACGGCAAGCTCGGCGAC
CTCTTCGGCCGCAAGGTCACCTACCTCTCGGCCATGGGTCTGTTCCTGCTCGGCTCCGCG
CTCGCGGGCGCCGCCGGCAGCATGGAGCAGCTCATCGTCTTCCGCATCGTGCAGGGGCTG
GGCGCCGGAGGGCTGTTCGTCTCCGTCCTCGCGATCATCGGCGAGCTGTTCACCCCGCGC
GAGGGCGCCAAGTACTACGGCATGTTCGGCATGGTCTTCGCCGGCGCCTCCCTGGCCGGC
CCGGCCGTGGGCGGTCTGCTCACCGACGCGCTCAGCTGGCACTGGGTCTTCCTGGTCAAC
CTCCCCGTCGGCGCCGTGATCGTCGCCCTGCTGGTCAAGTACCTGCACCTGCCCCGGAAG
GCCGCCGCGGGCGCCAAGCTCGACTACGCGGGCATCGTCACGCTCTCCGCGGCCATCATC
GCCCTCACCCTGCTCACGTCCTGGGGCGGCGTCGAGTACGCCTGGACCTCCCCGCAGATC
ATCGGGCTCGGCCTCGGCACCCTGGTCTTCCTCGGACTGTTCGTGAAGGCCGAGTCGACC
GCCTCGGAGCCGATCGTCCCGCTGCGCCTCTTCCGGGACTCCACCTTCACCATCTCGCTG
CTCGGCACCACCGTCTGCGGCATCGTCTTCGTCGGCGCGGTCCAGTTCCTCGCCCTGTAC
GTCCAGGTCGCCACCGGCGCCAGCCCCACCGCCTCCGGCTTCATCCTGCTGCCGATGATG
ATGGGCCTCGTGCTCTCCTCCGTGGGGTCGAGCCGGATCATCATGAAGACCGGCACGTAC
AAGATCTTCCCGATCCTGAGCATGGCGCTCGGCATCGTCGGAGCCCTCCTGCTGTCCACC
ATGGACTCGGACACCCCGCGCGTGCTCACCATCCTCTACATGGTGGTCTTCGGCTTCGCC
TCGGGCCTCTCGGCCCAGGTGTTCACGCAGGCGGCCCAGAACACCGCGCCCCCGCAGGAC
ATGGGCGCCGTCTCCGGCACCGTGACCTTCGGCCGCTCCTTCGGCACCTCGATCGGCATC
TCGCTCTTCGCGGCCGTCTTCTACGGACGGCTCACCGACGAACTCGCCGCCCGGGTGCCG
GACGGCGCCCTCGACGGCATCGACCGCAACTCGCTCTCCTCGGACACCGTCCTCGCCACC
CTCGCGGACCCGGTGCGCGGCGCCGTCGAGGACGCGTACGCGGCCTCGCTCACCCCGGTG
TTCACCACCGCCGTGCCGATCCTCGCGGTGGGCCTGGTCCTCACCCTGCTCATGAAGAAC
CTCACGCTCCGCTCCCGCCACCACGGCGCCGACGAGCCGGCCGAGAGCCCGGCGCCGGCC
GCCGCCGACGGCACCCCCGAGACGGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001411 Tetracycline resistance protein TetB/drug resistance transporter (Family)
 [25-49]  6.40000038788486e-11 PR01036 [115-135]  6.40000038788486e-11 PR01036 [145-169]  6.40000038788486e-11 PR01036 [211-229]  6.40000038788486e-11 PR01036
PR01036   TCRTETB
IPR011701 Major facilitator superfamily (Family)
 [27-419]  4.10000000000004e-44 PF07690
PF07690   MFS_1
IPR016196 Major facilitator superfamily domain, general substrate transporter (Domain)
 [1-515]  3.49999466863949e-68 SSF103473
SSF103473   MFS_gen_substrate_transporter
IPR020846 Major facilitator superfamily domain (Domain)
 [22-503]  PS50850
PS50850   MFS
SignalP
 [1-42]  0.812 Signal
Eukaryota   
TMHMM
 [20-42]  Transmembrane (i-o) [57-79]  Transmembrane (o-i) [86-108]  Transmembrane (i-o) [112-134]  Transmembrane (o-i) [146-168]  Transmembrane (i-o) [173-195]  Transmembrane (o-i) [207-229]  Transmembrane (i-o) [233-255]  Transmembrane (o-i) [276-298]  Transmembrane (i-o) [313-335]  Transmembrane (o-i) [342-359]  Transmembrane (i-o) [369-388]  Transmembrane (o-i) [409-431]  Transmembrane (i-o) [475-497]  Transmembrane (o-i)
Transmembrane 14