close all open/close all

CDS information : Griseo_00200


close this sectionLocation

Organism
StrainJP95
Entry nameGriseorhodin A
Contig
Start / Stop / Direction21,607 / 22,638 / + [in whole cluster]
21,607 / 22,638 / + [in contig]
Location21607..22638 [in whole cluster]
21607..22638 [in contig]
TypeCDS
Length1,032 bp (343 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.2 modification methylation
Productputative O-methyltransferase
Product (GenBank)putative methyltransferase GrhL
Gene
Gene (GenBank)grhL
EC number2.1.1.-
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[12323376] A gene cluster from a marine Streptomyces encoding the biosynthesis of the aromatic spiroketal polyketide griseorhodin A. (Chem Biol. , 2002)
Related Reference
ACC
P39896
PmId
[3460987] Anthracycline metabolites of tetracenomycin C-nonproducing Streptomyces glaucescens mutants. (J Bacteriol. , 1986)
[1548230] Nucleotide sequence of the tcmII-tcmIV region of the tetracenomycin C biosynthetic gene cluster of Streptomyces glaucescens and evidence that the tcmN gene encodes a multifunctional cyclase-dehydratase-O-methyl transferase. (J Bacteriol. , 1992)

close this sectionSequence

selected fasta
>putative O-methyltransferase [putative methyltransferase GrhL]
MTTTDDRTTAAAVDPGPLIKLTIADCAAKVLHSAVALGVFGALADGPADADQVAAATGLH
ERMAPDFLDALAGLGLLERTGDRYGNSPLAEAYLVPGTATYLGGFVELTNETLYGTWGRL
TEALTTGAPQHLDPDKGGFVGDRHKDPEKMKRFFAGLDAYSDRMGVEIARAVDWSRHTSF
TDLGGARGNLAAVLVKEHPHLTAGVFDLERTRPLFTEHTTRLGLDGRVAFTGGDFFTDDI
PKADVIVLGHILHGFGTDRRRELLNRVFAAVNPGGRVLVYDRMIDDERRDPERLLSSLHM
RLVSQDGSEYRVGDLRTWLAGAGFADSTAQPLLGTHTLVTAVR
selected fasta
>putative O-methyltransferase [putative methyltransferase GrhL]
GTGACAACGACCGATGACCGTACGACGGCCGCGGCGGTCGACCCCGGTCCGCTGATCAAG
CTGACCATCGCGGACTGCGCGGCGAAGGTGCTGCACAGCGCGGTGGCGCTCGGGGTGTTC
GGCGCCCTCGCCGACGGCCCGGCCGACGCGGACCAGGTCGCCGCCGCGACCGGCCTGCAC
GAACGCATGGCCCCCGACTTCCTCGACGCGCTGGCCGGCCTGGGCCTGCTGGAGCGCACG
GGGGACCGGTACGGCAACAGCCCGCTGGCCGAGGCGTACCTCGTGCCGGGCACCGCGACG
TATCTGGGCGGCTTCGTCGAGCTGACCAACGAGACCCTGTACGGCACCTGGGGGCGGCTG
ACCGAGGCGCTCACCACCGGGGCCCCGCAGCACCTCGACCCCGACAAGGGCGGCTTCGTC
GGCGACCGGCACAAGGACCCGGAGAAAATGAAGCGGTTCTTCGCGGGCCTCGACGCCTAC
AGCGACCGCATGGGCGTCGAGATCGCGCGCGCCGTCGACTGGAGCCGCCACACCTCCTTC
ACCGACCTCGGCGGCGCGCGCGGCAACCTGGCCGCCGTCCTGGTCAAGGAGCACCCGCAC
CTCACGGCCGGGGTCTTCGACCTGGAGCGCACCCGCCCGCTCTTCACCGAGCACACCACC
CGCCTCGGGCTCGACGGCCGCGTCGCGTTCACCGGCGGCGACTTCTTCACCGACGACATC
CCGAAGGCCGACGTCATCGTGCTCGGCCACATCCTGCACGGCTTCGGCACCGACCGCCGC
CGCGAACTGCTGAACCGCGTCTTCGCCGCGGTCAACCCCGGCGGCCGGGTGCTCGTCTAC
GACCGGATGATCGACGACGAGCGCCGCGATCCCGAACGGCTGCTCTCCAGCCTGCACATG
CGCCTGGTCAGCCAGGACGGTTCCGAGTACCGCGTCGGCGACCTGCGCACCTGGCTCGCC
GGGGCCGGATTCGCCGACAGCACCGCGCAGCCGCTGCTGGGCACGCACACGCTGGTCACC
GCCGTCCGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001077 O-methyltransferase, family 2 (Domain)
 [83-319]  1.5e-43 PF00891
PF00891   Methyltransf_2
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [13-91]  6.3e-24 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016461 O-methyltransferase, caffeic acid-type (Family)
 [1-337]  2.4000006166714e-08 PIRSF005739
PIRSF005739   O-mtase
SignalP No significant hit
TMHMM No significant hit