close all open/close all

CDS information : Griseo_00210


close this sectionLocation

Organism
StrainJP95
Entry nameGriseorhodin A
Contig
Start / Stop / Direction22,699 / 24,288 / + [in whole cluster]
22,699 / 24,288 / + [in contig]
Location22699..24288 [in whole cluster]
22699..24288 [in contig]
TypeCDS
Length1,590 bp (529 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.1 modification hydroxylation
Productputative hydroxylase
Product (GenBank)putative FAD-dependent monooxygenase GrhO8
Gene
Gene (GenBank)grhO8
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[12323376] A gene cluster from a marine Streptomyces encoding the biosynthesis of the aromatic spiroketal polyketide griseorhodin A. (Chem Biol. , 2002)
[19175308] Cleavage of four carbon-carbon bonds during biosynthesis of the griseorhodin a spiroketal pharmacophore. (J Am Chem Soc. , 2009)
Related Reference
ACC
Q8KSX0
NITE
Griseo_00220
ACC
Q8KSX7
NITE
Griseo_00150
ACC
Q2PWU9
PmId
[8830701] Purification and sequence analysis of 4-methyl-5-nitrocatechol oxygenase from Burkholderia sp. strain DNT. (J Bacteriol. , 1996)
[16751499] Protein engineering of the 4-methyl-5-nitrocatechol monooxygenase from Burkholderia sp. strain DNT for enhanced degradation of nitroaromatics. (Appl Environ Microbiol. , 2006)
ACC
Q9L4Y1
NITE
Ello_00070
PmId
[11325225] Cloning, sequencing, and heterologous expression of the elmGHIJ genes involved in the biosynthesis of the polyketide antibiotic elloramycin from Streptomyces olivaceus Tu2353. (J Nat Prod. , 2001)
ACC
P39888
PmId
[8509339] Nucleotide sequences and heterologous expression of tcmG and tcmP, biosynthetic genes for tetracenomycin C in Streptomyces glaucescens. (J Bacteriol. , 1993)

close this sectionSequence

selected fasta
>putative hydroxylase [putative FAD-dependent monooxygenase GrhO8]
MPVLIVGGGLTGLSAAVFLAHHGVRATLVERHPGASTHPKARAINPRTMELYRAVGMEER
VTAGRSPISGNTDLVHVETLAGAERVRMPNASVEDISRISPARWTLIDQNQLEPILRARA
EEVGVDLRFHTRLDAVTETADGVTATLTDVGTGGSTELRAAYVIAADGSRSPVRDLLSIG
SHGRGTLTNLVSFFFDADLEEPLRGRKIIAAYVNNPEVRGTIIPLDNDRKWVINVSFFPD
KGQSAEDFTPERCVELVRAAVGVPDLELTLDSVDMPAWDISARVADTFARGRFLVAGDAA
HVMPPTGAFGASTGIQDAYNLAWKLALVLADKAGPELLASYDAERRPVAEETVRQAMLRF
AVREGKQFQDVAKDLVDEMTMTFGYVYPAGAFTGEGAGAGNITEEPDKPSGRPGARAPHV
VIEGAHGPFSAVDLFPVGFTLLTAGASAPWAAAADAGRELGLVLQVRGVGAGGDYADTEG
TFTERYGVADGGAVLVRPDGVVAWRAGSAPEGDVAATVTGVLRRILALD
selected fasta
>putative hydroxylase [putative FAD-dependent monooxygenase GrhO8]
GTGCCCGTCCTCATCGTCGGCGGTGGCCTGACCGGGCTGTCCGCCGCCGTGTTCCTCGCC
CACCACGGGGTGCGGGCCACGCTCGTCGAGCGCCACCCCGGCGCCTCCACCCACCCCAAG
GCGCGGGCCATCAACCCGCGCACCATGGAGCTCTACCGCGCGGTGGGCATGGAGGAGCGC
GTCACGGCCGGCCGTTCGCCGATCTCCGGCAACACCGACCTGGTGCACGTCGAGACCCTC
GCCGGCGCCGAGCGGGTCCGCATGCCCAACGCCTCCGTCGAGGACATCAGCCGCATCAGC
CCGGCCCGGTGGACCCTGATCGACCAGAACCAGCTCGAACCCATCCTGCGCGCACGGGCC
GAGGAGGTCGGCGTCGACCTGCGCTTCCACACCCGGCTGGACGCCGTCACCGAGACCGCC
GACGGCGTCACCGCGACCCTCACCGACGTCGGGACCGGCGGTAGCACCGAACTGCGCGCC
GCGTACGTGATCGCCGCGGACGGCAGCCGCAGCCCGGTCCGCGACCTCCTCTCCATCGGC
TCCCACGGCCGCGGCACCCTCACCAACCTGGTCAGCTTCTTCTTCGACGCCGACCTGGAG
GAGCCGCTGCGCGGCCGGAAGATCATCGCCGCCTACGTCAACAACCCCGAGGTGCGCGGC
ACGATCATCCCGCTCGACAACGACCGCAAGTGGGTCATCAACGTCTCCTTCTTCCCCGAC
AAGGGCCAGAGCGCCGAGGACTTCACCCCGGAGCGCTGCGTCGAACTGGTCCGCGCCGCC
GTCGGCGTACCGGATCTGGAGCTGACCCTCGACTCGGTCGACATGCCCGCCTGGGACATC
TCTGCGCGGGTGGCGGACACCTTCGCCCGCGGCCGCTTCCTGGTGGCCGGGGACGCCGCG
CACGTGATGCCGCCCACCGGGGCCTTCGGCGCCAGCACCGGCATCCAGGACGCCTACAAC
CTGGCCTGGAAGCTCGCCCTCGTGCTGGCGGACAAGGCCGGGCCCGAGCTGCTCGCGAGC
TACGACGCGGAACGCCGCCCGGTCGCGGAGGAGACCGTCCGGCAGGCGATGCTGCGGTTC
GCGGTCCGCGAGGGCAAGCAGTTCCAGGACGTCGCCAAGGACCTGGTCGACGAGATGACG
ATGACCTTCGGCTACGTCTATCCGGCCGGCGCGTTCACCGGCGAGGGCGCCGGGGCCGGG
AACATCACCGAGGAGCCCGACAAGCCGAGCGGCCGCCCCGGCGCACGGGCCCCGCACGTC
GTGATCGAGGGCGCGCACGGGCCGTTCTCCGCGGTGGACCTCTTCCCGGTCGGCTTCACC
CTGCTCACCGCGGGCGCGTCCGCCCCCTGGGCGGCTGCGGCCGACGCGGGCCGGGAGCTG
GGCCTGGTCCTCCAGGTGCGCGGCGTCGGCGCGGGCGGCGACTACGCCGACACCGAGGGC
ACGTTCACGGAGCGCTACGGCGTCGCGGACGGCGGCGCGGTCCTGGTCCGCCCGGACGGG
GTGGTCGCCTGGCGCGCCGGGAGCGCCCCCGAGGGCGATGTCGCGGCGACGGTGACGGGC
GTCCTGCGGCGGATCCTCGCGCTGGACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002938 Monooxygenase, FAD-binding (Domain)
 [2-356]  5.90000000000008e-100 PF01494
PF01494   FAD_binding_3
IPR003042 Aromatic-ring hydroxylase-like (Domain)
 [2-24]  2.99998750445706e-42 PR00420 [159-174]  2.99998750445706e-42 PR00420 [290-305]  2.99998750445706e-42 PR00420 [305-321]  2.99998750445706e-42 PR00420 [323-341]  2.99998750445706e-42 PR00420 [341-357]  2.99998750445706e-42 PR00420
PR00420   RNGMNOXGNASE
SignalP
 [1-26]  0.993 Signal
Eukaryota   
 [1-26]  0.37 Signal
Bacteria, Gram-negative   
TMHMM No significant hit