close all open/close all

CDS information : Griseo_00220


close this sectionLocation

Organism
StrainJP95
Entry nameGriseorhodin A
Contig
Start / Stop / Direction26,118 / 24,529 / - [in whole cluster]
26,118 / 24,529 / - [in contig]
Locationcomplement(24529..26118) [in whole cluster]
complement(24529..26118) [in contig]
TypeCDS
Length1,590 bp (529 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.1 modification hydroxylation
Productputative hydroxylase
Product (GenBank)putative FAD-dependent oxidoreductase GrhO9
Gene
Gene (GenBank)grhO9
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[12323376] A gene cluster from a marine Streptomyces encoding the biosynthesis of the aromatic spiroketal polyketide griseorhodin A. (Chem Biol. , 2002)
[19175308] Cleavage of four carbon-carbon bonds during biosynthesis of the griseorhodin a spiroketal pharmacophore. (J Am Chem Soc. , 2009)
Related Reference
ACC
Q8KSX1
NITE
Griseo_00210
ACC
Q8KSX7
NITE
Griseo_00150
ACC
Q2PWU9
PmId
[8830701] Purification and sequence analysis of 4-methyl-5-nitrocatechol oxygenase from Burkholderia sp. strain DNT. (J Bacteriol. , 1996)
[16751499] Protein engineering of the 4-methyl-5-nitrocatechol monooxygenase from Burkholderia sp. strain DNT for enhanced degradation of nitroaromatics. (Appl Environ Microbiol. , 2006)
ACC
P39888
PmId
[8509339] Nucleotide sequences and heterologous expression of tcmG and tcmP, biosynthetic genes for tetracenomycin C in Streptomyces glaucescens. (J Bacteriol. , 1993)
ACC
Q9L4Y1
NITE
Ello_00070
PmId
[11325225] Cloning, sequencing, and heterologous expression of the elmGHIJ genes involved in the biosynthesis of the polyketide antibiotic elloramycin from Streptomyces olivaceus Tu2353. (J Nat Prod. , 2001)

close this sectionSequence

selected fasta
>putative hydroxylase [putative FAD-dependent oxidoreductase GrhO9]
MAERTDVLIVGGSMVGLAQALFLAQQGIRSILVERHTHISAHPRAQAASPRTMELMRALG
LEQKVRARENPHAQYGDILQVESLTGRELGRFDGPFRHDPNEVSTTGWTLIGQDRFEPVL
RAKAEELGADIRFATEMVSYEQDADGVTAVLRDVRGGEETEVEAAYLVAADGFRSTVRDG
LGIGTHGQGVFGRQMNVIFHAALDPYVAERRFFLCFVSNDRVKGVLGRLDDGDRWVLAPS
LPPEKTHAAYSEEDCVAMVRAAVGVPDLDVAVESSTSWEVAARIADRFRSGRVFLAGDAA
HVMPPTGGFGGNMGVQDAHNLAWKLAAVLRGQAGPALLDTYEEERVPVAEFTVEQGVIRY
LQRSGLDEEVAARHRPETTVLFGHVYRSGGVLAESGGEDGPPVEDPTQPSGRPGARAPHV
ELRVGGVDTPLHDLLRGGWWLLAGPDAGLWERAAAQVSRLTGLVVDFHRVGGEEPVETVE
GFLKKYGITTGGAVLVRPDGFVAWRAAGQPADPAVELSAVVHRLLGRPA
selected fasta
>putative hydroxylase [putative FAD-dependent oxidoreductase GrhO9]
GTGGCGGAGCGAACCGACGTACTGATCGTGGGCGGCAGCATGGTGGGCCTCGCCCAGGCC
CTGTTCCTCGCCCAGCAGGGCATCCGGTCGATCCTGGTGGAGCGCCATACGCACATCTCG
GCGCACCCCCGGGCCCAGGCGGCCAGCCCCCGCACGATGGAGCTGATGCGCGCGCTGGGG
CTGGAGCAGAAGGTGCGCGCGCGGGAGAACCCGCACGCGCAGTACGGCGACATCCTCCAG
GTGGAGTCGCTGACGGGCCGTGAACTGGGCCGGTTCGACGGGCCGTTCCGGCACGACCCG
AACGAGGTGAGCACGACCGGCTGGACCCTGATCGGCCAGGACCGGTTCGAGCCCGTGCTG
CGCGCCAAGGCCGAGGAGCTGGGCGCGGACATCCGGTTCGCCACCGAGATGGTGTCCTAC
GAGCAGGACGCCGACGGGGTCACCGCGGTGCTGCGGGACGTGCGCGGGGGAGAGGAGACC
GAGGTCGAGGCCGCGTACCTGGTCGCGGCGGACGGCTTCCGCAGCACCGTCCGCGACGGA
CTGGGGATCGGCACCCACGGACAGGGCGTCTTCGGCCGCCAGATGAACGTCATCTTCCAC
GCCGCGCTCGACCCGTACGTTGCGGAGCGCCGGTTCTTCCTCTGCTTCGTCAGCAACGAC
CGGGTCAAGGGCGTCCTCGGCCGGCTCGACGACGGGGACCGCTGGGTGCTGGCTCCGAGC
CTGCCGCCCGAGAAGACGCACGCCGCGTACTCCGAGGAGGACTGCGTCGCCATGGTGCGC
GCCGCGGTCGGCGTACCGGACCTGGACGTGGCCGTGGAGTCCAGCACGAGCTGGGAGGTG
GCCGCCCGGATCGCCGACCGGTTCCGTTCGGGACGGGTGTTCCTGGCCGGTGACGCGGCC
CATGTGATGCCGCCCACCGGGGGGTTCGGCGGCAACATGGGGGTGCAGGACGCGCACAAC
CTGGCGTGGAAGCTGGCGGCGGTCCTGCGGGGGCAGGCGGGCCCCGCCCTGCTGGACACC
TACGAGGAGGAGCGCGTCCCGGTCGCGGAGTTCACCGTGGAGCAGGGCGTCATCCGCTAT
CTGCAGCGCAGCGGTCTGGACGAGGAGGTCGCGGCCCGCCACCGGCCGGAGACCACGGTG
CTGTTCGGCCACGTCTACCGCTCGGGCGGGGTGCTGGCGGAGTCCGGCGGCGAGGACGGC
CCCCCGGTGGAGGACCCGACCCAGCCGTCCGGCCGCCCCGGCGCCCGCGCGCCCCACGTC
GAGCTGCGCGTCGGCGGTGTGGACACCCCGCTGCACGACCTGCTCAGGGGCGGCTGGTGG
CTGCTGGCCGGCCCGGACGCCGGGCTGTGGGAGCGGGCGGCCGCCCAGGTGTCCCGGCTC
ACCGGCCTCGTGGTCGACTTCCACCGGGTGGGCGGTGAGGAGCCGGTCGAGACAGTCGAG
GGCTTCCTGAAGAAGTACGGCATCACGACCGGCGGCGCGGTCCTGGTCCGCCCGGACGGG
TTCGTCGCCTGGCGCGCGGCCGGGCAGCCGGCGGACCCGGCGGTCGAACTCTCGGCGGTC
GTCCACCGGTTGCTGGGGCGCCCGGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002938 Monooxygenase, FAD-binding (Domain)
 [4-354]  2.39999999999997e-105 PF01494
PF01494   FAD_binding_3
IPR003042 Aromatic-ring hydroxylase-like (Domain)
 [6-28]  1.79999754022375e-44 PR00420 [163-178]  1.79999754022375e-44 PR00420 [290-305]  1.79999754022375e-44 PR00420 [305-321]  1.79999754022375e-44 PR00420 [323-341]  1.79999754022375e-44 PR00420 [341-357]  1.79999754022375e-44 PR00420
PR00420   RNGMNOXGNASE
SignalP
 [1-20]  0.524 Signal
Eukaryota   
TMHMM
 [7-24]  Transmembrane (i-o)
Transmembrane 1