close all open/close all

CDS information : Griseo_00230


close this sectionLocation

Organism
StrainJP95
Entry nameGriseorhodin A
Contig
Start / Stop / Direction26,432 / 26,884 / + [in whole cluster]
26,432 / 26,884 / + [in contig]
Location26432..26884 [in whole cluster]
26432..26884 [in contig]
TypeCDS
Length453 bp (150 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.1 modification hydroxylation
Productputative hydroxylase
Product (GenBank)GrhM
Gene
Gene (GenBank)grhM
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[12323376] A gene cluster from a marine Streptomyces encoding the biosynthesis of the aromatic spiroketal polyketide griseorhodin A. (Chem Biol. , 2002)
[19175308] Cleavage of four carbon-carbon bonds during biosynthesis of the griseorhodin a spiroketal pharmacophore. (J Am Chem Soc. , 2009)
Related Reference
ACC
Q2MGC4
NITE
Fred_00150
PmId
[19620242] In vivo investigation of the roles of FdmM and FdmM1 in fredericamycin biosynthesis unveiling a new family of oxygenases. (J Biol Chem. , 2009)

close this sectionSequence

selected fasta
>putative hydroxylase [GrhM]
MVETLSVLVLLGTGLVAGVLFAVAVSVMPALIAMEPERYVDTHKLLGKRYDRIMPFIVSG
SVVIDAAFAVRADATGPRVLFIAAALAMTGVAVVSQTRNVPINNRVKKTRPDELGPGWED
PRGQWRDWHLLRTCFAVAGCSLTAAAVVLS
selected fasta
>putative hydroxylase [GrhM]
ATGGTGGAAACCCTGAGTGTGCTGGTGCTGTTGGGCACCGGCCTGGTGGCGGGGGTGCTG
TTCGCCGTGGCGGTCAGCGTCATGCCCGCCCTGATCGCGATGGAGCCGGAGCGCTACGTC
GACACGCACAAGCTGCTCGGCAAGCGGTACGACCGCATCATGCCGTTCATCGTGAGCGGC
TCCGTCGTCATCGACGCGGCCTTCGCCGTGCGGGCGGACGCGACCGGGCCGCGAGTGCTG
TTCATCGCCGCCGCCCTGGCCATGACCGGGGTCGCCGTCGTCTCGCAGACCCGCAACGTG
CCCATCAACAACCGGGTCAAGAAGACGCGGCCCGACGAGCTCGGGCCCGGCTGGGAGGAC
CCGCGCGGCCAGTGGCGGGACTGGCATCTGCTGCGCACCTGCTTCGCCGTCGCCGGCTGC
TCCCTGACCGCCGCCGCGGTGGTGCTGTCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR013901 Protein of unknown function DUF1772 (Family)
 [18-146]  6.50000000000001e-28 PF08592
PF08592   DUF1772
SignalP
 [1-33]  0.618 Signal
Eukaryota   
 [1-33]  0.993 Signal
Bacteria, Gram-positive   
 [1-22]  0.994 Signal
Bacteria, Gram-negative   
TMHMM
 [10-32]  Transmembrane (o-i) [53-70]  Transmembrane (i-o) [80-102]  Transmembrane (o-i)
Transmembrane 3