close all open/close all

CDS information : Griseo_00240


close this sectionLocation

Organism
StrainJP95
Entry nameGriseorhodin A
Contig
Start / Stop / Direction27,019 / 27,462 / + [in whole cluster]
27,019 / 27,462 / + [in contig]
Location27019..27462 [in whole cluster]
27019..27462 [in contig]
TypeCDS
Length444 bp (147 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)GrhN
Gene
Gene (GenBank)grhN
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in griseorhodin A biosynthesis.
Note (GenBank)
Reference
ACC
PmId
[12323376] A gene cluster from a marine Streptomyces encoding the biosynthesis of the aromatic spiroketal polyketide griseorhodin A. (Chem Biol. , 2002)
[19175308] Cleavage of four carbon-carbon bonds during biosynthesis of the griseorhodin a spiroketal pharmacophore. (J Am Chem Soc. , 2009)

close this sectionSequence

selected fasta
>hypothetical protein [GrhN]
MVALLTGPEPGPVAEHLALLHFTGRRSGAAHTVPAGLHRVGGGLFVATGSPWRHNFAGGA
PGEITWRGNRSPVRFTLVTDGERTARGYHELYERYGPEAAQRRLGITVDAAATPTPADFR
AAVTGIPLALVAVDLLTASVTNERTSR
selected fasta
>hypothetical protein [GrhN]
ATGGTCGCCCTGCTGACCGGCCCGGAGCCCGGCCCGGTCGCCGAGCACCTGGCCCTGCTG
CACTTCACCGGTCGGCGCAGCGGCGCGGCGCACACCGTCCCGGCGGGCCTGCACCGCGTC
GGGGGCGGGCTGTTCGTCGCCACCGGCAGCCCCTGGCGGCACAACTTCGCCGGCGGGGCG
CCCGGCGAGATCACCTGGCGCGGCAACCGCTCCCCCGTCCGCTTCACGCTGGTCACCGAC
GGGGAGCGGACCGCCCGCGGCTACCACGAGCTGTACGAGCGCTACGGCCCCGAGGCCGCC
CAGCGCCGCCTGGGCATCACCGTGGACGCCGCCGCCACGCCCACCCCGGCCGACTTCCGG
GCCGCCGTCACCGGCATCCCGCTCGCCCTGGTGGCCGTGGACCTCCTGACCGCATCCGTC
ACGAACGAGAGGACCTCCCGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR016791 Rubromycin-type polyketide biosynthesis protein, GrhN/RubW, predicted (Family)
 [1-147]  3.79997359309398e-89 PIRSF021513
PIRSF021513   GrhN_RubW_prd
SignalP
 [1-29]  0.304 Signal
Bacteria, Gram-positive   
TMHMM No significant hit