close all open/close all

CDS information : Griseo_00250


close this sectionLocation

Organism
StrainJP95
Entry nameGriseorhodin A
Contig
Start / Stop / Direction27,459 / 29,336 / + [in whole cluster]
27,459 / 29,336 / + [in contig]
Location27459..29336 [in whole cluster]
27459..29336 [in contig]
TypeCDS
Length1,878 bp (625 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative amide synthetase
Product (GenBank)putative class II glutamine amidotransferase GrhP
Gene
Gene (GenBank)grhP
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[12323376] A gene cluster from a marine Streptomyces encoding the biosynthesis of the aromatic spiroketal polyketide griseorhodin A. (Chem Biol. , 2002)
[19175308] Cleavage of four carbon-carbon bonds during biosynthesis of the griseorhodin a spiroketal pharmacophore. (J Am Chem Soc. , 2009)
Related Reference
ACC
Q3S8R1
NITE
Oxtet_00050
PmId
[16597959] Engineered biosynthesis of a novel amidated polyketide, using the malonamyl-specific initiation module from the oxytetracycline polyketide synthase. (Appl Environ Microbiol. , 2006)
[21622525] Genetic characterization of enzymes involved in the priming steps of oxytetracycline biosynthesis in Streptomyces rimosus. (Microbiology. , 2011)
ACC
Q2MGB4
NITE
Fred_00250
PmId
[20926388] Characterization of FdmV as an amide synthetase for fredericamycin A biosynthesis in Streptomyces griseus ATCC 43944. (J Biol Chem. , 2010)
ACC
O05272
PmId
[10498721] Three asparagine synthetase genes of Bacillus subtilis. (J Bacteriol. , 1999)

close this sectionSequence

selected fasta
>putative amide synthetase [putative class II glutamine amidotransferase GrhP]
MSAIAGWVDFERDLSPQAATVETMAAALAHRGPDGRGVWAEGHAALAHRRLALLDLTETG
AQPAVHTTEGGAAVAVLTLDGALTNHTELRARLAAKGHRFTGRGDGETALHAYLEWGADF
LTRLEGLFAIAVWDVRRQELLLARDRLGVKPLSYHPTPTGVLFGSEPKAILAHPDVDAVV
DADGLRELFAHSRKPGTGVFRGMREVVPGHALIVRRPGSREQRYWSLPAREHTDSLDTTV
ATVRGLLADAVASHTRADAPVGAMLSGGIDSSALSALAHRDLTAAGSGPLRTFSVNFTGY
TENFEPHPTMRSTPDAPFAALASRHIGSRHTEFLLDTAALTDPGVHTAALRSQDAPSPLG
DMDVSLLRFFARLREEGFAAVLSGETADEVFNGYFWAYDPKHSNSQTFPWVSFERGHDAA
AGGLGTSMIDRELRKRLDFLGYADQHYRDALTEVPHVDGDTAAERRAREVTYLALTRWAP
THLDRADRMSMAHGVQLRPPFCDRALVEYVYNVPAAMKRVDGVEKSLLRSAVADLLPDEV
LHRRKSAYPTTQEAAYGDFVRQRFAELAADRDAAVAELLDTTATAEAVAADGSPQGAFAW
VERAGMEMALQLDTWLTDYRVDLRL
selected fasta
>putative amide synthetase [putative class II glutamine amidotransferase GrhP]
ATGAGCGCAATCGCCGGCTGGGTCGACTTCGAGCGGGACCTGTCCCCGCAGGCCGCGACC
GTCGAGACCATGGCGGCCGCCCTGGCCCACCGCGGCCCGGACGGCCGGGGCGTCTGGGCG
GAGGGGCACGCCGCCCTCGCGCACCGGCGCCTGGCCCTGCTCGACCTGACGGAGACCGGC
GCGCAGCCGGCCGTCCACACCACCGAGGGGGGCGCCGCCGTCGCCGTCCTCACGCTCGAC
GGAGCGCTGACCAACCACACCGAGCTGCGGGCCCGACTGGCCGCGAAGGGCCACCGGTTC
ACCGGCCGGGGCGACGGCGAGACCGCCCTGCACGCCTATCTGGAGTGGGGGGCGGACTTC
CTCACCCGCCTGGAGGGCCTGTTCGCGATCGCGGTGTGGGACGTACGCCGTCAGGAGCTG
CTGCTGGCCCGCGACCGCCTCGGCGTCAAGCCGCTGAGCTACCACCCGACGCCCACCGGG
GTCCTGTTCGGGTCCGAGCCCAAGGCGATCCTGGCCCACCCGGACGTCGACGCGGTCGTC
GACGCCGACGGGCTGCGCGAGCTGTTCGCACACAGCCGCAAGCCGGGCACCGGCGTCTTC
CGGGGGATGCGCGAGGTCGTCCCCGGTCACGCGCTGATCGTCCGTCGCCCCGGCAGCCGG
GAGCAGCGGTACTGGTCGCTGCCCGCGCGGGAGCACACCGACAGCCTCGACACGACCGTC
GCCACCGTGCGCGGCCTGCTCGCGGACGCCGTCGCCTCCCACACGCGCGCCGACGCCCCG
GTGGGCGCCATGCTCTCCGGCGGCATCGACTCCAGCGCCCTGAGCGCCCTCGCCCACCGC
GACCTCACCGCCGCCGGCTCCGGCCCGCTGCGCACCTTCTCGGTCAACTTCACGGGGTAC
ACCGAGAACTTCGAGCCCCACCCCACGATGCGCTCGACGCCCGACGCCCCGTTCGCGGCC
CTCGCCTCGCGGCACATCGGCTCCCGGCACACCGAGTTCCTGCTGGACACGGCCGCCCTC
ACGGACCCCGGGGTGCACACCGCCGCCCTGCGCAGCCAGGACGCCCCCTCGCCGCTCGGC
GACATGGACGTCTCCCTCCTGCGGTTCTTCGCCCGGCTGCGCGAGGAGGGGTTCGCGGCC
GTGCTCTCCGGGGAGACCGCCGACGAGGTCTTCAACGGCTACTTCTGGGCGTACGACCCG
AAGCACAGCAACTCGCAGACCTTCCCCTGGGTCTCCTTCGAGCGCGGCCACGACGCCGCG
GCCGGCGGTCTCGGCACCTCGATGATCGACCGCGAACTGCGCAAGCGGCTGGACTTCCTG
GGCTACGCGGACCAGCACTACCGGGACGCCCTCACCGAGGTCCCGCACGTCGACGGGGAC
ACCGCGGCCGAACGCCGGGCTCGCGAGGTCACGTATCTCGCGCTGACCCGCTGGGCCCCC
ACCCACCTGGACCGCGCCGACCGCATGAGCATGGCGCACGGCGTCCAGCTCCGGCCGCCC
TTCTGCGACCGGGCGCTCGTCGAGTACGTCTACAACGTGCCGGCCGCCATGAAGCGGGTG
GACGGCGTCGAGAAGAGCCTGCTGCGCTCCGCCGTCGCCGACCTGCTGCCCGACGAGGTC
CTGCACCGCCGGAAGAGCGCCTACCCCACCACCCAGGAGGCGGCCTACGGCGACTTCGTG
CGCCAACGGTTCGCCGAGCTGGCCGCCGACCGGGACGCGGCCGTGGCCGAGTTGCTCGAC
ACCACCGCCACCGCCGAGGCGGTGGCCGCCGACGGCTCCCCGCAGGGCGCCTTCGCCTGG
GTCGAGCGGGCCGGCATGGAGATGGCGCTCCAGCTCGACACCTGGCTCACCGACTACCGG
GTCGACCTGCGGCTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000583 Class II glutamine amidotransferase domain (Domain)
 [48-172]  6.19999999999994e-34 PF13537
PF13537   GATase_7
IPR001962 Asparagine synthase (Domain)
 [243-545]  1.2e-60 PF00733
PF00733   Asn_synthase
IPR006426 Asparagine synthase, glutamine-hydrolyzing (Family)
 [1-624]  2.1000026783403e-81 PIRSF001589
PIRSF001589   Asn_synthetase_glu-h
 [3-548]  2.90000000000003e-126 TIGR01536
TIGR01536   Asn_synth_AEB
IPR014729 Rossmann-like alpha/beta/alpha sandwich fold (Domain)
 [225-406]  4.09999999999995e-65 G3DSA:3.40.50.620 [468-617]  4.09999999999995e-65 G3DSA:3.40.50.620
G3DSA:3.40.50.620   Rossmann-like_a/b/a_fold
IPR017932 Glutamine amidotransferase type 2 domain (Domain)
 [2-217]  PS51278
PS51278   GATASE_TYPE_2
SignalP No significant hit
TMHMM No significant hit