close all open/close all

CDS information : Griseo_00260


close this sectionLocation

Organism
StrainJP95
Entry nameGriseorhodin A
Contig
Start / Stop / Direction29,428 / 29,799 / + [in whole cluster]
29,428 / 29,799 / + [in contig]
Location29428..29799 [in whole cluster]
29428..29799 [in contig]
TypeCDS
Length372 bp (123 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative cyclase
Product (GenBank)putative cyclase GrhQ
GenegrhQ
Gene (GenBank)grhRQ
EC number
Keyword
  • pentangular
Note
Note (GenBank)
Reference
ACC
PmId
[12323376] A gene cluster from a marine Streptomyces encoding the biosynthesis of the aromatic spiroketal polyketide griseorhodin A. (Chem Biol. , 2002)
Related Reference
ACC
P39890
PmId
[8218177] Tetracenomycin F2 cyclase: intramolecular aldol condensation in the biosynthesis of tetracenomycin C in Streptomyces glaucescens. (Biochemistry. , 1993)

close this sectionSequence

selected fasta
>putative cyclase [putative cyclase GrhQ]
MHRTLIVARMNLADAECVGKVFADSDSTDLPHMVGVSRRTLFAFHDLYFHLVEAEQDISP
NLYKARSHPLYNDVNTRLQEFISPYDPDWREPRDAMAVPFYSWTPESGPVITRPAAPNLG
GGR
selected fasta
>putative cyclase [putative cyclase GrhQ]
GTGCACCGCACCCTGATCGTGGCCAGGATGAACCTGGCGGACGCCGAATGCGTCGGCAAG
GTCTTCGCCGACTCGGACAGCACCGACCTGCCGCACATGGTGGGCGTCTCCCGGCGGACG
CTGTTCGCCTTCCACGACCTGTACTTCCACCTCGTCGAGGCGGAGCAGGACATCAGCCCG
AACCTCTACAAGGCCCGCAGCCACCCGCTGTACAACGACGTCAACACCCGGCTGCAGGAG
TTCATCTCCCCCTACGACCCGGACTGGCGCGAGCCGCGCGACGCGATGGCCGTCCCGTTC
TACTCGTGGACTCCGGAGAGCGGTCCCGTCATCACCCGGCCGGCCGCCCCGAACCTGGGC
GGTGGCCGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006765 Polyketide synthesis cyclase (Family)
 [2-103]  PD012644
PD012644   Polyketide_synth_cyclase
 [1-106]  4.39999999999997e-48 G3DSA:3.30.70.1090
G3DSA:3.30.70.1090   Cyclase_polyket
 [10-104]  1.6e-40 PF04673
PF04673   Cyclase_polyket
IPR011008 Dimeric alpha-beta barrel (Domain)
 [1-106]  8.00002659346736e-45 SSF54909
SSF54909   Dimer_A_B_barrel
SignalP
 [1-23]  0.234 Signal
Bacteria, Gram-positive   
 [1-23]  0.202 Signal
Eukaryota   
TMHMM No significant hit