close all open/close all

CDS information : Griseo_00280


close this sectionLocation

Organism
StrainJP95
Entry nameGriseorhodin A
Contig
Start / Stop / Direction30,227 / 31,507 / + [in whole cluster]
30,227 / 31,507 / + [in contig]
Location30227..31507 [in whole cluster]
30227..31507 [in contig]
TypeCDS
Length1,281 bp (426 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase beta-ketoacyl synthase subunit
Product (GenBank)putative ketosynthase alpha GrhA
Gene
Gene (GenBank)grhA
EC number
Keyword
  • type II PKS
Note
Note (GenBank)
Reference
ACC
PmId
[12323376] A gene cluster from a marine Streptomyces encoding the biosynthesis of the aromatic spiroketal polyketide griseorhodin A. (Chem Biol. , 2002)
Related Reference
ACC
Q54173
NITE
Urd_00120
PmId
[7592377] Cloning and characterization of a polyketide synthase gene from Streptomyces fradiae Tu2717, which carries the genes for biosynthesis of the angucycline antibiotic urdamycin A and a gene probably involved in its oxygenation. (J Bacteriol. , 1995)

close this sectionPKS/NRPS Module

KS3..375

close this sectionSequence

selected fasta
>polyketide synthase beta-ketoacyl synthase subunit [putative ketosynthase alpha GrhA]
MSRRAVITGIGAVAPGGIGRDAYWDLLAHGRTATRRISRFDASAFRSQVAAECDFDPVAA
GLSPQEVRRMDRAAQFAVVAAQEAIEDSGIDVGAGDPGRTAVSIGSAVGCTTGLEDEYAV
LSDGGRNWLVDHTYGVPHLYGYMVPSTLAAEVAWRARAEGPVALISTGCTSGLDAIAHGV
QLIEEGAADIVLAGATDAPLSPITSACFDAIKATTPNADQDPGSASRPFDGRRDGFVLGE
GSAVMVIEEAGAARRRGATVYAEVAGFANRSNAFHMTGLKPDGREMAEAIRVALDRARLD
PGAIDHVNAHGSGTKQNDRHETAAFKRSLGQRAHEIPVSSIKSMIGHSLGAIGSLEVAAC
ALALRHQVVPPTANLTVPDPQCDLDYVPVTAREHRMDHVLSVGSGFGGFQSAMILSRPGA
RKEAVA
selected fasta
>polyketide synthase beta-ketoacyl synthase subunit [putative ketosynthase alpha GrhA]
GTGAGCCGACGCGCCGTCATCACGGGGATCGGAGCCGTCGCTCCCGGCGGCATCGGACGG
GACGCGTACTGGGACCTGCTCGCGCACGGCCGTACGGCCACCCGGCGGATCAGCCGGTTC
GACGCGTCGGCGTTCCGCTCGCAGGTCGCCGCCGAATGCGACTTCGACCCGGTCGCCGCG
GGGCTGAGCCCGCAGGAAGTGCGCCGGATGGACCGGGCCGCCCAGTTCGCGGTGGTCGCG
GCCCAGGAGGCGATCGAGGACAGCGGCATCGACGTCGGCGCGGGCGACCCGGGGCGGACC
GCGGTCAGCATCGGCAGCGCGGTCGGCTGCACCACCGGCCTGGAGGACGAGTACGCGGTC
CTCTCGGACGGCGGCCGGAACTGGCTGGTCGACCACACCTACGGGGTCCCGCACCTGTAC
GGCTACATGGTCCCCAGCACGCTGGCGGCCGAAGTGGCCTGGCGGGCGCGGGCGGAGGGC
CCGGTGGCACTGATCTCGACCGGCTGCACCTCCGGTCTCGACGCGATCGCCCACGGCGTG
CAGCTCATCGAGGAGGGCGCCGCCGACATCGTCCTGGCGGGCGCCACCGACGCCCCGCTG
TCCCCCATCACCTCCGCCTGCTTCGACGCGATCAAGGCGACGACGCCCAACGCGGACCAG
GACCCGGGCAGCGCCTCCCGCCCCTTCGACGGCCGCCGCGACGGCTTCGTGCTGGGCGAG
GGCTCGGCGGTCATGGTGATCGAGGAGGCCGGGGCGGCCCGCCGCCGGGGGGCCACCGTC
TACGCCGAGGTGGCCGGTTTCGCCAACCGCTCCAACGCCTTCCACATGACCGGGCTCAAG
CCCGACGGGCGGGAGATGGCCGAGGCCATCCGGGTCGCCCTGGACCGCGCGCGGCTCGAC
CCCGGCGCGATCGACCACGTCAACGCGCACGGCTCCGGCACCAAGCAGAACGACCGGCAC
GAGACGGCCGCCTTCAAGCGGTCCCTGGGGCAGCGCGCCCACGAGATCCCGGTCAGCTCC
ATCAAGTCGATGATCGGGCACTCCCTGGGGGCGATCGGCTCCCTGGAGGTGGCCGCCTGC
GCCCTGGCGCTGCGCCACCAGGTGGTGCCGCCCACGGCGAACCTCACGGTCCCCGACCCC
CAGTGCGACCTGGACTACGTCCCGGTCACCGCCCGGGAGCACCGCATGGACCACGTCCTC
AGCGTCGGCAGCGGATTCGGCGGCTTCCAGAGCGCCATGATCCTCAGCCGGCCCGGAGCC
CGTAAGGAGGCGGTCGCGTGA
KS3..375
KS7..1125

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [3-250]  6.59999999999996e-59 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [261-375]  1.29999999999998e-38 PF02801
PF02801   Ketoacyl-synt_C
IPR016038 Thiolase-like, subgroup (Domain)
 [7-266]  4.6e-62 G3DSA:3.40.47.10 [271-417]  1.80000000000002e-53 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [2-420]  8.30001403791594e-64 SSF53901
SSF53901   Thiolase-like
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [160-176]  PS00606
PS00606   B_KETOACYL_SYNTHASE
SignalP
 [1-19]  0.725 Signal
Eukaryota   
TMHMM No significant hit