close all open/close all

CDS information : Griseo_00290


close this sectionLocation

Organism
StrainJP95
Entry nameGriseorhodin A
Contig
Start / Stop / Direction31,504 / 32,766 / + [in whole cluster]
31,504 / 32,766 / + [in contig]
Location31504..32766 [in whole cluster]
31504..32766 [in contig]
TypeCDS
Length1,263 bp (420 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase chain length factor subunit
Product (GenBank)putative ketosynthase beta GrhB
Gene
Gene (GenBank)grhB
EC number
Keyword
  • type II PKS
Note
Note (GenBank)
Reference
ACC
PmId
[12323376] A gene cluster from a marine Streptomyces encoding the biosynthesis of the aromatic spiroketal polyketide griseorhodin A. (Chem Biol. , 2002)
Related Reference
ACC
Q54496
NITE
Nogl_00380
PmId
[8668120] A gene cluster involved in nogalamycin biosynthesis from Streptomyces nogalater: sequence analysis and complementation of early-block mutations in the anthracycline pathway. (Mol Gen Genet. , 1996)

close this sectionPKS/NRPS Module

CLF12..369

close this sectionSequence

selected fasta
>polyketide synthase chain length factor subunit [putative ketosynthase beta GrhB]
MSALGLPAGRRSPAAVTGLGIVAPTGIGVRRHWESVLAGKSGLGRITRFDPAGYPVEVAG
EVPGFTAGEQVPRGLVDRTDRFTHFALAAAEAALADADADPAQLPEYDMAVVTAASSGGT
EFGQHEMERLYQRGPAWVGAYQSIAWFYAATTGQVSIRHGMRGPCGVLCAEQAGGLDALG
QSRRLLDTGSRLVLSGGTDASLCPYGLTAQLSTGALSASDDPARAYLPFDEAAAGYAPGE
GGAMLLVETERGARERGVRSYGRILGYAAGFDPPSSSGRPPVLASVVRRAVADAGIGADA
VDVVFADAAGTPELDRAEAAAINEVFGAGRVPVTAPKTLTGRLYAGGAPLDVATALLALS
AGVIPHTPGVERPAPGLGIDLVVGGPRRTGARTAVVLARGHGGFTSALVVEGGDRTDHTA
selected fasta
>polyketide synthase chain length factor subunit [putative ketosynthase beta GrhB]
GTGAGCGCGCTCGGCCTGCCCGCGGGGCGCCGCAGCCCGGCGGCCGTCACCGGCCTCGGC
ATCGTCGCCCCCACCGGCATCGGCGTCCGGCGGCACTGGGAGTCGGTGCTGGCCGGCAAG
AGCGGCCTCGGCCGCATCACCCGCTTCGACCCGGCCGGCTACCCGGTCGAGGTGGCCGGG
GAGGTGCCCGGCTTCACCGCGGGCGAGCAGGTGCCCCGGGGGCTGGTCGACCGGACCGAC
CGGTTCACCCACTTCGCCCTGGCCGCCGCCGAGGCGGCCCTCGCCGACGCGGACGCCGAC
CCGGCGCAGCTGCCCGAGTACGACATGGCCGTGGTCACCGCCGCCTCCTCCGGCGGCACC
GAGTTCGGCCAGCACGAGATGGAGCGGCTCTACCAGCGGGGCCCGGCGTGGGTCGGCGCG
TACCAGTCGATCGCCTGGTTCTACGCCGCCACCACCGGCCAGGTCTCCATCCGCCACGGC
ATGCGCGGCCCCTGCGGGGTCCTGTGCGCCGAACAGGCGGGCGGCCTGGACGCGTTGGGC
CAGTCCCGGCGGCTGCTGGACACCGGCTCCCGGCTGGTGCTCAGCGGCGGCACGGACGCC
TCGCTGTGCCCGTACGGGCTGACCGCCCAGCTGTCCACGGGGGCGCTGTCGGCCTCGGAC
GACCCGGCGCGGGCGTACCTGCCGTTCGACGAGGCCGCCGCCGGCTACGCGCCCGGGGAG
GGCGGGGCCATGCTCCTCGTCGAGACCGAGCGCGGCGCGCGGGAGCGGGGGGTCCGCTCG
TACGGCCGGATCCTCGGCTACGCGGCGGGGTTCGACCCGCCGTCCTCCTCCGGCCGCCCG
CCCGTACTGGCCTCGGTCGTCCGCCGGGCGGTCGCGGACGCGGGGATCGGCGCGGACGCC
GTGGACGTGGTCTTCGCCGACGCGGCGGGCACACCGGAGCTGGACCGTGCCGAGGCCGCC
GCGATCAACGAGGTGTTCGGCGCCGGCCGGGTGCCGGTGACCGCGCCCAAGACCCTCACC
GGGCGGCTGTACGCGGGCGGGGCCCCGCTCGACGTGGCGACCGCCCTGCTCGCCCTGTCC
GCCGGCGTGATCCCGCACACCCCGGGCGTCGAACGCCCCGCGCCCGGCCTCGGCATCGAC
CTGGTCGTCGGCGGGCCGCGGCGGACCGGGGCCCGTACCGCCGTGGTGCTCGCCCGGGGT
CACGGCGGGTTCACCTCCGCCCTGGTGGTCGAGGGGGGCGACCGAACCGACCACACCGCC
TGA
CLF12..369
CLF34..1107

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [12-250]  2.19999999999997e-44 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [261-369]  4.00000000000001e-23 PF02801
PF02801   Ketoacyl-synt_C
IPR016038 Thiolase-like, subgroup (Domain)
 [12-266]  1.2e-48 G3DSA:3.40.47.10 [275-411]  3.29999999999997e-33 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [11-258]  5.8999880940569e-55 SSF53901 [221-411]  3.89999861795218e-43 SSF53901
SSF53901   Thiolase-like
SignalP
 [1-28]  0.726 Signal
Eukaryota   
TMHMM No significant hit